SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30046049m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30046049m
Domain Number 1 Region: 66-141
Classification Level Classification E-value
Superfamily EF-hand 0.00000016
Family Calmodulin-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30046049m
Sequence length 191
Sequence
MDKCICCLIFLLHSVSSTINEETEHLGLHLGDKLDFDEEGARHLYEHLSEIIDLPDDFQY
GKFSNEQGRFFFFISHDFDRNNKLDGLECLALLTDFYDPKDSKSSGKLVSELSITEVVTL
VDELLFKHDLDGDGYIDFAEINNPNVESVWTKMSEVIDVVEKRLEEGHVLTDPHIHHPSE
EEETLNLTTKI
Download sequence
Identical sequences Sakowv30046049m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]