SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Sakowv30008217m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30008217m
Domain Number 1 Region: 399-630
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.89e-31
Family Calponin-homology domain, CH-domain 0.00017
Further Details:      
 
Domain Number 2 Region: 95-250,394-476
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000179
Family FAD/NAD-linked reductases, N-terminal and central domains 0.079
Further Details:      
 
Domain Number 3 Region: 1226-1257
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000143
Family LIM domain 0.011
Further Details:      
 
Weak hits

Sequence:  Sakowv30008217m
Domain Number - Region: 1258-1294
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0162
Family LIM domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sakowv30008217m
Sequence length 2954
Sequence
SGGSSNTVSMQYREDETNYGDCLFEQFVHANTFRTILNTFKELCDFLQIQPDDFKSCYPF
LKNRLTSWKAKTLWNKLDKRASHKEYKRGKACANTKVFVIGCGPCGLRTAIEASLLGAKV
VVVEKRDRFSRNNVLHLWPYVIEDLKSLAAKKFYGKFCAGSIEHISIRQLQCILLKVSLL
YGVEVHGNVTFEGLLEPPEEQEEQRIGWKALVSPSSHPVADYEFDVLIGADGKRNTLGGF
KRKEFRGKLAIAITANFINRFTLAEQRVEEISGVAYIFNQKFFQDLKAQTLIDLENIVYY
KDETHYFVMTAKKQSLLEKGVLLEDYTDTESLLSPENISQEALLQYAREAADFSSNHKLP
RLDFALNHYGLPDVAMFDFTSMFAAETAARVVERNGCQLLVALVGDSLLEPFWPTGSGCA
RGFLGVFDTAWMIKSWASGRKTPLEVLAERESIYRLLAQTTPENLHKNFHQYTIDPRSRY
PNLNMKAVDPESVLSLYDDGTDVRLESLKLEKVKTKVQRKGSVVRSSKLLLWCQKAVENY
PGIQVDNITSSWKNGLLLCAIIQRFRPDLINYECLKAEEVAENNQLAFDIAEREFGITPV
MTGKEMASLSQPDKLTMVAYLSQFYEIFKDELPLETVKQVDLPEEEFIPGRKAQRLSLLT
RLNKKLSQKKSPRREKDYGNREEKENQRKSPAGGSRRREIARRYHEDLLNAENEAKLWDK
REDLNVGVRGANKVSAMANSLFAQFQEIAGVKQTPSKAVNRPSFVVGSSHSSPINTMAEQ
LYEQFEVLAGQKHQSQLEGKRSMTSKNKQIQDMAEQLRAHFQKADSSQMEPRYGDQVQEM
VTLLQDQFNRLAGCESADIEPIDKPQISVSTHYHIKDMAVKLENNFKDITSMSPKPVAGE
QRPQVSPQQQGKIKELAEELHNKFAAMTAVQHPELVLDRRRSLSHIKAMSDTLLTQFKEK
QRQQHTCSEPTGHINRMAEHLLEQCQQIAIEKEAAQQVTPSKKSVSVKAQQLQAKFKELS
GEKPTIKEPPKRATHGAKKPVDTGALSHRQVHDMAGQILNKFEQISNPSIEKSKSASSAS
STEVQFMTYQLLAKVEEMAKQTAEPKKITQISEGQLQETTDRFLSDMQERQKQPEKTNVT
TGVGSIYDILMARFQPVEEDNTSKDDNQDEPLTELNIADRMLFSKFRDIAGLKSTRAEDQ
QKEPKQRTSWWGSQQPKSKQFTGSSAGGSDICFFCCKRVYVMERLSAEGLFFHRGCFKCS
YCNTTLRIGNYAFYMPPNENKLEGRFYCRPHFKYSKAADGGPRKRRMMELGAKENLPDSP
PVLVTTTPDKQSWLAELDGPLEKKSRGTPDHLNRSWESLSNCTPERIFLDSTLDGTLQRS
QMSEEEISNYNYGDAASVHEMTEYDESSSSDDSDVEFDIEPVAIPAEHSDHWQKSPQWDL
SDDDDYSWDESDNDYEEDDYDYESDDDLSDGEMVPVEVDSRNLAWTEPESPKENVMAENE
VNNIESDAEGEKTPEAADSSNEELQPLSESLTKQEFPEIQQTEPQPEPQNKDSPEELFDH
QGFVASMTSLKLQWLSNPEPPDHSMWGRRRLPSKTPKTVSLEEEKPPPIPPLPSQEDLVK
AHIIKAEDMTAEKVKPDIDDEDTSVETVEEVVLVDKVTEEEEIIKEQLPKGDLVSVIEVE
EKEAATLMMNDDELKVQDLEEGEILMDEIEENELGEVPVNTCHIEEEYEDDFEEDVDEDH
KFDETGSLDAFEDEIETLEWNSATDKTGILDVPIVEDKVSHNLHQETLLKESKTNLGDVV
EQEAVLNADDDKDDNDLINDIDDVVKHKAVDNADDDNDLINDIDDVVKHKVVDNDLINNV
VEQEVIVDNGNALIDVTDGVVAINSDNTKKDSLDEKQDTVHVEQLNGIDEIEKSSDSDEA
NIAEIYGATLAYIDDQSESVSEKDDLTSNDTMDAVDREKDFEELACFTPREDKPNGNVVN
HDTEHVESYEQNLADVYGETLARIETTESPVDEKKIEDIFRYQQSIGDSAEILTADEKQD
LAVGEKSQLMDEDIKDDTIKAEIQSLKSMCENTEDKEAVIDDSFTSFVVIDDDVAGNQER
FAVSDEEVEMGVECLENKSYVNTPECTPELNIDARNITVRKVRTLESVSSDFAIISCSDP
SLVSHDIPSICDFEKESEVEESFCNISLAGQTTDSATIQDLDVSFNSTCEDSSNIYATPD
SSLNYGDTFFESLDKTDRTSTMSTEHSSRPESVISLENIDCINEDLNISIMSTDSDSNDS
IRETLEMYAKELEYQSTRDAGGDEDTLPRTPGDESKLFPTVELKDQRNNVQSRDEMETKT
KNEMETKTKNEMEIRTKDEMKTKTKNEMEIRTKDEMKIGTKDEMPILEVKEKETQKTKKK
HQKKKMHVDSFDDIFVKENRSAEVVNKKSDKARTEKKVKGKAKKYVASDVNDESSAAKCD
TLSAKGDTVYKGTAKAKVEEKRKESESALKYRPLPVAPSALKGAVKSDEGGVTKSKTPKH
EIRKEKKTFDQLPSKKGSRDSSPVVTVSPGDKEVEFNKSPKKAGKKLSSTGKACGSADGK
SPKSPKERKGNTLKKLKDEIKKIDLDGKSKSPSKSKPDTSLVKESSKSKMNNKKKNENTR
EKSPEKKVLAPLAKLDMSDDLLSDDCVLMDQPSVKPKVQTSGSYKPRPLPPRPDTKGDGS
GSIVSTGDQGASSTSSDIEDLSGMVPPLSTEKKKSKKKSFTKKLKGKPQLSDSEVNAKLT
KRVQKAVKKQHRQEELKRLRLAQEIQRQLQEVEVKQKQLEVRGVEVEKTLRGESDEVSSS
PDEVPSSPVGEKDETVLMQEWFTLVNEKNALVRVEQELSIRAKELELEDRHSRLQQELRD
KMSTQDSKKSKKELDEEKKLLAEMLEVVEQRDALVALLEEERLKEKDQDKSIETVMLKKG
FNITSEKKQSIEEQ
Download sequence
Identical sequences Sakowv30008217m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]