SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Sakowv30021150m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30021150m
Domain Number 1 Region: 613-869
Classification Level Classification E-value
Superfamily YWTD domain 5.49e-59
Family YWTD domain 0.00000347
Further Details:      
 
Domain Number 2 Region: 312-561
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-54
Family YWTD domain 0.00000281
Further Details:      
 
Domain Number 3 Region: 2-261
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-53
Family YWTD domain 0.0000018
Further Details:      
 
Domain Number 4 Region: 922-1181
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-41
Family YWTD domain 0.0000345
Further Details:      
 
Domain Number 5 Region: 1230-1269
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000785
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 1270-1305
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 7 Region: 569-615
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000134
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 8 Region: 264-308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000168
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 9 Region: 1308-1350
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000406
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 10 Region: 1187-1239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000187
Family EGF-type module 0.022
Further Details:      
 
Domain Number 11 Region: 872-925
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000502
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30021150m
Sequence length 1593
Sequence
EPLLLYANRQDVRMVDTGTNPPNDTIIISGLEDAAALDFYHNEKIVFWTDVSLEMIKRTF
VNGSRIVENIITTGLVSPDGLACDWLGKKLYWTDSETNRIEVSNLDGSSRKVLFWEDLDQ
PRAIALDPHRGWMYWTDWGETPKIERAGMDGIEREVIVQTDIYWPNGLTIDYDAQRIYWA
DAKLNYIHHANFDGSDRSPVAEGSLPHPFALTLFTDTLFWTDWHTRSIHSCHKNTGENRK
VVHEDIFSPMDIHVYSAVRQPSGANPCGQNNGDCSHLCLMSPHPPKYTCACPTGVRLLTN
GRTCADGAEEILLLARRTDLRRISLDTPDYTDVVLQLEDIQHAIAIDYDPVDGYIYWTDD
EVRAIRRASMDGTGGEFIVTTEVEHPDGLAVDWVGRNLYWTDTGNDRIEVARLNGTSRTI
LISEDLDEPRAIALDPADGYMYWTDWGSKPKIERAALDGTDRTVLINSSLGWPNGIALDF
IERKIYWGDAKTDKIEMANMDGTGRQVLVVDLPHIFGFSLLGDYIYWTDWQRRSIERVNK
HNGQDREVIIDQLPDLMGLKAVNVKKIEGTNVCAHDNGGCSHLCLYRPIGVICACPIGLE
LLQDQKTCIVPEAFLLFSRRADIRRISLETNNNDVVIPLAGVKEAAALDFDINDNRIYWS
DIRRKAISRAFMNGSSLEHVIEFGLEYPEGMAVDWVAHNIYWADTGTNRIEVARLDGSAR
RVLLWQDLEEPRALALDPSEGFMYWTDWGGNPKIERANMDGSNRKLIVTDVGRTNGLTID
YSDRRMYWTDLDMNQIESADLMGQHRRSVIGEKLPKPFGLTQYQDYIYWTDWATRSIERV
NKTSGENRTRIQGQLDYVMDILVFHASRQSGSNQCALNNNGCEYLCFADPPNLIGELQSH
CACPTHYTLREDNKTCSPPESFLLYSQRNLISRMTVNLDDSPDIVLPIHGLRIVKAIEYN
YKTKQIYWVDGRTKTIKRSYDNGLEPETFLPNPGDEPKFHPHDLALDPYSGLIYWTCSQT
NVINVTRLDMTEVGVVIRDDTEKPRAIVLDPERGYMYWTSVSQNKPRIMRAAMDGADKTV
IISSSLSEPEALAIDTESNKLFWSDVTLHRIESSDLNGGNRNVLVDSQLSTPHALTIFGT
HLYWIDKDSMLIERVDKINGDQREKILGRLTQLSDIHAVRNNYPSADSHPCAINNGGCSH
ICFLVDGVKTCACPIDLVLSDSRTTCGEPPTCSPDHFTCKSGNIECIPQAWVCDTIPECA
DESDEQNCPTCSKLQFHCKSGQCIDKKLRCNGEPDCNDESDEKFCQAPCWKDQFECSNGQ
CVDSELAECNDIIECDDGSDEVNCDHHSVVEPNTSPVRSAGSMHSLIGAVVGFIFVIIVI
GIAMWWWRRYKLQPDSMCDNQFVMLNNHQNNYTAMVGVGPQQTTPPRSISGISKCHTKSI
NTCLSVSTVPAGSNVQHYDRSHVTGASSSGSSMGSHYPKETLNPPPSPVTERSHYTAELY
YPSHSPHTSRSYRHYKSRNIPPPPTPCSTDVCEDSEPYSRPNKRKYYSNPYPPPPTPQSV
LSDNYESCPPSPSTERSFCNPYPPPPSPATDSP
Download sequence
Identical sequences Sakowv30021150m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]