SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Sakowv30030155m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30030155m
Domain Number 1 Region: 784-832
Classification Level Classification E-value
Superfamily Histone-fold 0.000000000000684
Family TBP-associated factors, TAFs 0.0042
Further Details:      
 
Domain Number 2 Region: 562-612
Classification Level Classification E-value
Superfamily TAFH domain-like 0.00000000000628
Family TAFH domain-like 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Sakowv30030155m
Sequence length 1000
Sequence
MASADSSLEDILTSEVDESAVSALVGSLESQLAAQIAGVPQGQVSANSVTNNHVGDVPIT
STNIVQSAQSALQKAVVLGNTRNSNSNSLSNSPVTIVDQTKNGSNNQSVTINSVVSSGVT
TPTAVVAPTTMPQQNATSTATTCVRIITLPSTNVTGRHVLTTQHLANSTKATTVTSSSPL
NVGARTSVSGSSANTTTPTVVRIVTTQGIQTNVPSSTTPVVSSVQNLNTKVLTTQGITPP
VKLTVREQLAHHQINKQTNVPQVILKRESNTPPQQTMSIAQSTGTVVKSTVSNTPQYVTV
NVPGQGAITIPTSSLSGNTRVISTSQPQLQHKVLTPPRFVSAPIRIAAAPQAIAPRPTGI
PLSQGLTLPPGMMLVKQEGGNYLIQNTAVAGTLQAKPNACSVPGTATYRFTTVQPGTQVV
TGPPQVSMHQQPSVHQQQVVTMQQQHHQQQQQPAGSVQKSGSNIAASSHLQTQSPIVIQH
MQKGISNNPPNATTSTQSVPMTTITSVPLSSGVAMPTTSIPSISTASQVVSSTAPGTIIP
TPTTTTTTLGAQTIIPVPQSAMENVKKCRNFLTTLIKLASNQPAETIRNVKDLVQSLIRS
LPLLRQTLHKSPIQGLTAPMLTSTGLNAATITVTSTTAGTSTAMPVTNTITLTQQQLQQL
QQQQKLQQMQKLQQDQLGKLQHSKHVGARHIVVTQHGTSVDGVTTASNFTAATAKSFKGH
HPVTFTSPSHKDRAKYSSTFKDDDDINDVASMAGVNLSEESARILATNAEFIGTQLRSCK
DEHFLHSGPLQKRISDICKKFGLDEPSSEMSNIISHATQERLKTLVEKLALIAQHRMEVY
KNDSRYEMTDDIKSKLRFFEQLDALERKRHDEQEREMLLRAAKSRSRQEDPEQLRLKQKA
KEMQQMEMEQMRKRDANMTALLAIGPRKKRKIDSPIPGSSSSFSQGGGNNSTVNSSSSSS
LGNRPQIKRVKRVNLRDLVFLLEQEKETKKSTLLYKAFLK
Download sequence
Identical sequences Sakowv30030155m XP_002739729.1.86028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]