SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Sakowv30032665m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30032665m
Domain Number 1 Region: 27-146
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 9.81e-29
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30032665m
Sequence length 159
Sequence
MKWLLLFVAIAVTTATITTSKNDANKYKEGKQYTYHYEGLVKNGLPSTGREYTGLKITCN
PQLTFLTNEIIILKLRSPRLYEYNTTRHIHYKDSSLTNKFHEELLTPIKFYYIYGKVEKV
FAPEHEPEWTLNIKKGILSLLNLEMLDIDEDLSTFTTYE
Download sequence
Identical sequences Sakowv30032665m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]