SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Sakowv30032951m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30032951m
Domain Number 1 Region: 414-653
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.57e-84
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 288-391
Classification Level Classification E-value
Superfamily SRCR-like 8.11e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00015
Further Details:      
 
Domain Number 3 Region: 51-156
Classification Level Classification E-value
Superfamily SRCR-like 1.09e-34
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000709
Further Details:      
 
Domain Number 4 Region: 4-44
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000103
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 5 Region: 160-199
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.00086
Further Details:      
 
Weak hits

Sequence:  Sakowv30032951m
Domain Number - Region: 217-253
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00275
Family Hairpin loop containing domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30032951m
Sequence length 657
Sequence
MALNLHEVTCDGGLFACPNGQCIEASWVCDGDNDCGDFTDESDCGTVEPRPVEIRLVDGS
SSNEGRVEVFYMGTWGIICDDLWDINDAHVICKQLGYQRGAESAIGNSMYGSGNGVFLLD
DVECTGSENSIAECPNTGWAVHNCAPDEAASVVCMTDDATICDDDQFTCHGGTMCISDTW
VCDGDNDCGDNSDEENCPTPMRPTGPDCVYERDIDRKGSNLLSGDANWVPSREECCLTCQ
NSAGCMAWTFDKRPGPTYGECWLKSEIGDPFVSDCCDSGVLSDEPVDFSKIRLVGGSSPQ
QGRLEVFYNGEWGTVCDDDFNELSAQVVCRQLGISGMVQFHAEALPFGQGSGQIWMDDVS
CDGTESYLEQCSRTDWGDHNCGHREDVGVTCGVELPPTIEPGTCGSKPVQRLGPSLRIVG
GEQAEPGEWPWQVALQLKGSGHYCGATVINEHYIISAAHCFERYGKDSFTVVVGDHDNEM
PEGKEQEYDIQCLTSHENYNSETTDNDIALIKVEPKNGRGMIFTDYVMSACLPVTDIQFL
AGHECWTSGWGSTGSDYPAKLREALTPLISTTECNRPTGYAGKVTNNMLCAGYMRGGTDS
CQGDSGGPLVCERDGVWTLWGVTSWGYGCGSANYPGVYTKVANYVAWINDHMATGSC
Download sequence
Identical sequences Sakowv30032951m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]