SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Sakowv30043213m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30043213m
Domain Number 1 Region: 14-155
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.51e-33
Family G proteins 0.0000624
Further Details:      
 
Domain Number 2 Region: 158-194
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000085
Family SOCS box-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30043213m
Sequence length 236
Sequence
GLEDGVADSPYGQYTNGIEHKTTTILLDGKKVKLQLWDASGQGRFCTIFRSYSRGAQGIL
LVYDITNKWSFDGIDRWIKEVEEHAPGVPKILVGNRLHLAFKRQVSTDLAESYAMKNEMD
FFEVSPLCDFNIVESLTELSRKVLKRNGMERLWRPSKVLSLQDLCCQAIVKCTCIYSVDK
LPLPTQLRSRLKSFGNGHHQHRYLPHRDSKSKRSRTIPLNPYDSPPMNCRKSCCVS
Download sequence
Identical sequences Sakowv30043213m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]