SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Sakowv30046098m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30046098m
Domain Number 1 Region: 3799-3870
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000131
Family SH3-domain 0.00073
Further Details:      
 
Domain Number 2 Region: 3670-3759
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000791
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 3 Region: 2357-2585
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000124
Family Tropomyosin 0.0018
Further Details:      
 
Domain Number 4 Region: 2215-2426
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000183
Family Tropomyosin 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sakowv30046098m
Sequence length 3920
Sequence
MKMADTWERSSTPGICSPRSKSPPTSPRPGTPRSIPSPRPPALGRLTPDAQALEDFERER
FHCRLSELVHLVRRLEDENSKLQRAKEALEGKLKNADFTSERNKLNKIIEDLEHDKKRLE
NTCKTLNEENKKKISLSKLPIRRQESVGYGSRRSSSTDSSDNSEAEKFKKIMDDNFKTIT
ELKNQIIEKDRRLDLIQHRRRKARRRQSGILESPKGLEDEIGLDTASITSSISQRSDNSI
SGEWDEFERAEMEGNYQQLSKEYLQLKKAYTQLQAMVGGSLDVQREFKLREQLELDLLDS
QAKIEDFQKVIKDQGKDAGWVEEKQKFITYNRNLQSKVEEKEDAIKKVKRDLNDSRDQNE
LLEFRILELEERSESSHTAVPESLSSLSPSSPNTIVRRSPSPAALPLIQVTETDGISLQI
AVNETGFTLVRPVSVQQDMSVVDIKQKLEDIANNKDDDRLSVEDKKSLLQARAMLDIADL
KLKKMTSSETSLKRKVMDLEHEKDRLAAKVSSTEVELRSNLNVLDDCNKKIDELEEIIED
RKKSESKFHAMEDVYLKNESKLKDEIKLLKKQMSSDKEGRDYENELLFQKIAEVRDEKQK
VAILEESNSALQEKLDRVSDSSLQSKLDSLVKEDTLAAKEGAESKQIELKSVMTLEELQH
LKAKVDEIKAAHQKIAEMEQTELVLRKHIEALEREIVELQENIQHHESSYNEKVEEYEIR
EHTLKEISRKAEQAEVQLKEQLDASISEDSKKGEQIQELCLKIKILESSETSSKQKFDSD
AINQNLDTELKQLKSENEKLSNQLNSYELAEKELKGQINQIKVENDVLKDKLQLLEIENP
NLKSLPGDKTDDDKENGDVLKMKDRIWELESSEKVLEADLFDLKEENEKLKSKLMNGDSE
PMHSEIEVSETQEQTINDLRTSQTSLKEALSKTTSEKENLLKMYQDALEKLQELETDEKI
DQSPSLDVTSEAQVQSSVEQPIERVTVENVSMPQNLLLNMDSQKEQSYADRVYELQASEN
VLKNIVKDLQVSEEELNNKIVELTSEKAELVAQLRDANLKDEESEKVIKEHENEVSMLKM
KIGEIETTKEKLEEESALLTRQLEVANQKLQEVEEKNAEVNKLNNDLQVSEAQMKEEMLE
MSSEKEEIEVKLLEAREELKKTNERIDNLTASESNLSEQLNNVITEKETLAADLKESNVR
LVNQEQRLESVIAAAGEEKVKVLTKENDELTQKLEEAENRIEEQDIQETVLKKIINELED
SEKTSRERIVELEESGKTVKAALDGQEKTSEDLREKLDEVEKSEKELQEKVLQLENSDKD
LRDKLSELESAQLDSSNNEALMKEIKELELEVQRRKDIEVDLKEDHFEELTSLQEQIQDL
ERTNQELRKKLAELSEELECIDELKKEHLSEVSNLQGKIKDLENQNAEDSNKFEDLKQSL
SMEIATLKEQVDDLENSERDIRSKLSQNSDALFKSQKSYEEDQKMWNEKEHHLKDQLSES
EVVIKTLNEKVQALQQQEVTLKKEVEKQEEIKVKASEREIATYSLQERIAELQECESLLK
AKIIELTESEESAKKNYQETLKDRIENEKAWKVKIKDLEDTEDKSRLRLQEMEVVEIDLR
EQLEAKVRENEVASEMWRQSEDLLNERVAELEELETVLKQRIQELEDNESHLKQEIKQKT
KETENTWKQAAESSTLAYQERIHELEELEGDLKDRISQLAEAERTAKDMLQEATVVYREN
EEALKERIEQLEEDQGEMQGQIHALENLKAMMRGQIEDAEQHNKETQKANKRLQEKIEQF
ESGEQAHKDELNRMKKQLETTEQAEKESQKLLSQQLEDIQTESKSNEKNLRDRVKELEYS
DNELQNKLYETETVKTELEDRLESAEIENKRVKESNNHLKEQIDELEEENSKLRRDLEDT
QEKADESERISSELKDRLHETESVGDMKKMEEQKSLEKIQKQIEELQMSEEMLKDDVEHL
ERSERKLKQKLTEKNADIDKLYQQRKVEKDEMRSRILDLEMSEMKLKEQVHVLDMEVKKK
TWDIERIQPQIKFQTEQIDTVGKQEIKHKELANCLRKKVEQLEQREKDLKNDIMMASDSQ
SPLKEKLSRSERRETELVKKVERLEKSEETLKAAVLSLEQAKDTKTKKEIEELNEQVQQL
EDVADKLRHDLKRSENSEKSIKKLHTALEDDFSYLKEEESKLRNRLKDIEKEKGQSKKRY
DEDYEELQDKVIALEKVEQTLKKKLESSKKTEEALQKELNTAEEMFDKTENTLKQTNKAL
ERKLKQLEEAIDRSQLREKELETSGNSLQQKLKMLEKSECALKDQVSELENQELNFKHQV
RELESAERMLKMDNDQLKLEKDLLTDKMDDVKKSESDLQKKTGELQMNEKKLKEKVVALE
KQLNVLREKVKEMETSAATMETRCAQASKLEKELSDTQDELQESHTKIDQLERAKASLKR
QLENLEDDLATGQMITLPLEEYKRMKAQTGLLEMTEQSVEDLEKTEAKLQDKLKKMEEQK
DYCDADKEILNLRLQLDEKNEINKELQDKFDESQIHLKTAQRQGADLRNIHSAVKKELNE
LKESLENGDILSGIYTKRNSKSTQTDALRYLGGTALQSRVYTPENKQTTLLEFLETLPYN
AQIPKTTVEYPKSVLPELKLDNIADRLMLCTSKGLVDVDSKPGYFMQSATLQMEKTADLD
KIRLIEELVEHLPQYETNTAQVKTSPPRRLYAVREMTRRTTIPDKSMPSPRALDTSRPYE
RKKLIEALVAVLPQGDPELPSEWIRPKTVQYGKLVDEPQMCANGVFRAEFNTDIVVSQPS
PPPLPDTMPPPIQFQTLPSSFDETQHCDSPVPNFFDVNGIDSESDFSDVDLPPLPASEPP
SASHLVIESSRKQATLHVQRPPSFDSGMETQSTGTDREYADENTSAFVFPVPGKPLTLPR
VPSEEGPETCPKPPTPLWVTKMVQRQLSERDSHEAEKDQLKRKIVDLTAESELQEKEEAL
EEKCKLSKSLRMENTQLHAEFRDKNGQLTSLKAEVMRLERLLRGSHSDDGQVAALREELE
GKQKQLQDKKEEMNKMTNLNDVYRTKLDRREKDLAAKEQELEQKNSELQKLRHEVGGLEQ
QKKIAQTSADSKYNELAGKYEALKQEFQAKCLELDSTLEELKSLKKKYEDLKNKLKDLEK
IRDERDIILGKLQALEAALKLKADQEQKLFEELAMLTRKLEDYEKLNTTRDGIEESFREI
KNNYDDMEHKKREAELAVAPLKAKVSRLVKKCKERDELIKKLTNELRQQHKGHPNELLEA
VTKLQSRMPDEEYNEPMSPYSTTLHGIHEVSEVTRENSDVGVESSPSLSSLYTRRTPTLP
TRMINELSEPLWQTIESSSPATVGRHQQPQLDVDNIQDTDEAAMQELLRSLSSDPIGSSS
NRSTSSQVAATLPQTSATTRDRKSPGSALQELLTVDPELARMLDRGSNMGDGRDSGDMLQ
GTGSSERPRSSTPRRQRPRDSSHLRQSPEEILRLHSRLSETRSNPYEFNYEPSPSLAEEA
SQLEQLHNINSPMFIDGVPIATSPRLSMSLPQPVSSQPLSSKNLPQLSAPTLLSMGVQPT
QNIGSVPAAFSSIPGTHNGNIPSSANGGVPTYLRGAGLDRPDLGSLSLSNSSMLSPAGLP
TAALLPPTLACKSEGPPLSPSDFCISRIVSSRSVLLTWVPPAMDEMAKSNGAQVAGYRVY
LNNKQKQLVNSAHLTKALIENIDIRIPVTFSIETVSVTGQTSHRVEMQFDGNMLSPFLTE
SMASESAADTEVSSIFSDFEEPQKRTFMAIYDYIPADHSPNDYPAFELQFNEGDIITIYG
PPRPDGFYHGKLHGKKGLVPSNFIEEIHVSGNKGRKKKKSRSQGSLHNGHSSTASDSPRQ
RSGRNNRPPPGKNSLGGSRV
Download sequence
Identical sequences Sakowv30046098m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]