SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Sakowv30046106m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30046106m
Domain Number 1 Region: 3342-3413
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000118
Family SH3-domain 0.00073
Further Details:      
 
Domain Number 2 Region: 3213-3302
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000721
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 3 Region: 1873-2101
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000118
Family Tropomyosin 0.0018
Further Details:      
 
Domain Number 4 Region: 1731-1942
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000124
Family Tropomyosin 0.00095
Further Details:      
 
Weak hits

Sequence:  Sakowv30046106m
Domain Number - Region: 519-725
Classification Level Classification E-value
Superfamily Tropomyosin 0.00641
Family Tropomyosin 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Sakowv30046106m
Sequence length 3463
Sequence
MTSSETSLKRKVMDLEHEKDRLAAKVSSTEVELRSNLNVLDDCNKKIDELEEIIEDRKKS
ESKFHAMEDVYLKNESKLKDEIKLLKKQMSSDKEGRDYENELLFQKIAEVRDEKQKVAIL
EESNSALQEKLDRVSDSSLQSKLDSLVKEDTLAAKEGAESKQIELKSVMTLEELQHLKAK
VDEIKAAHQKIAEMEQTELVLRKHIEALEREIVELQENIQHHESSYNEKVEEYEIREHTL
KEISRKAEQAEVQLKEQLDASISEDSKKGEQIQELCLKIKILESSETSSKQKFDSDAINQ
NLDTELKQLKSENEKLSNQLNSYELAEKELKGQINQIKVENDVLKDKLQLLEIENPNLKS
LPGDKTDDDKENGDVLKMKDRIWELESSEKVLEADLFDLKEENEKLKSKLMNGDSEPMHS
EIEVSETQEQTINDLRTSQTSLKEALSKTTSEKENLLKMYQDALEKLQELETDEKIDQSP
SLDVTSEAQVQSSVEQPIERVTVENVSMPQNLLLNMDSQKEQSYADRVYELQASENVLKN
IVKDLQVSEEELNNKIVELTSEKAELVAQLRDANLKDEESEKVIKEHENEVSMLKMKIGE
IETTKEKLEEESALLTRQLEVANQKLQEVEEKNAEVNKLNNDLQVSEAQMKEEMLEMSSE
KEEIEVKLLEAREELKKTNERIDNLTASESNLSEQLNNVITEKETLAADLKESNVRLVNQ
EQRLESVIAAAGEEKVKVLTKENDELTQKLEEAENRIEEQDIQETVLKKIINELEDSEKT
SRERIVELEESGKTVKAALDGQEKTSEDLREKLDEVEKSEKELQEKVLQLENSDKDLRDK
LSELESAQLDSSNNEALMKEIKELELEVQRRKDIEVDLKEDHFEELTSLQEQIQDLERTN
QELRKKLAELSEELECIDELKKEHLSEVSNLQGKIKDLENQNAEDSNKFEDLKQSLSMEI
ATLKEQVDDLENSERDIRSKLSQNSDALFKSQKSYEEDQKMWNEKEHHLKDQLSESEVVI
KTLNEKVQALQQQEVTLKKEVEKQEEIKVKASEREIATYSLQERIAELQECESLLKAKII
ELTESEESAKKNYQETLKDRIENEKAWKVKIKDLEDTEDKSRLRLQEMEVVEIDLREQLE
AKVRENEVASEMWRQSEDLLNERVAELEELETVLKQRIQELEDNESHLKQEIKQKTKETE
NTWKQAAESSTLAYQERIHELEELEGDLKDRISQLAEAERTAKDMLQEATVVYRENEEAL
KERIEQLEEDQGEMQGQIHALENLKAMMRGQIEDAEQHNKETQKANKRLQEKIEQFESGE
QAHKDELNRMKKQLETTEQAEKESQKLLSQQLEDIQTESKSNEKNLRDRVKELEYSDNEL
QNKLYETETVKTELEDRLESAEIENKRVKESNNHLKEQIDELEEENSKLRRDLEDTQEKA
DESERISSELKDRLHETESVGDMKKMEEQKSLEKIQKQIEELQMSEEMLKDDVEHLERSE
RKLKQKLTEKNADIDKLYQQRKVEKDEMRSRILDLEMSEMKLKEQVHVLDMEVKKKTWDI
ERIQPQIKFQTEQIDTVGKQEIKHKELANCLRKKVEQLEQREKDLKNDIMMASDSQSPLK
EKLSRSERRETELVKKVERLEKSEETLKAAVLSLEQAKDTKTKKEIEELNEQVQQLEDVA
DKLRHDLKRSENSEKSIKKLHTALEDDFSYLKEEESKLRNRLKDIEKEKGQSKKRYDEDY
EELQDKVIALEKVEQTLKKKLESSKKTEEALQKELNTAEEMFDKTENTLKQTNKALERKL
KQLEEAIDRSQLREKELETSGNSLQQKLKMLEKSECALKDQVSELENQELNFKHQVRELE
SAERMLKMDNDQLKLEKDLLTDKMDDVKKSESDLQKKTGELQMNEKKLKEKVVALEKQLN
VLREKVKEMETSAATMETRCAQASKLEKELSDTQDELQESHTKIDQLERAKASLKRQLEN
LEDDLATGQMITLPLEEYKRMKAQTGLLEMTEQSVEDLEKTEAKLQDKLKKMEEQKDYCD
ADKEILNLRLQLDEKNEINKELQDKFDESQIHLKTAQRQGADLRNIHSAVKKELNELKES
LENGDILSGIYTKRNSKSTQTDALRYLGGTALQSRVYTPENKQTTLLEFLETLPYNAQIP
KTTVEYPKSVLPELKLDNIADRLMLCTSKGLVDVDSKPGYFMQSATLQMEKTADLDKIRL
IEELVEHLPQYETNTAQVKTSPPRRLYAVREMTRRTTIPDKSMPSPRALDTSRPYERKKL
IEALVAVLPQGDPELPSEWIRPKTVQYGKLVDEPQMCANGVFRAEFNTDIVVSQPSPPPL
PDTMPPPIQFQTLPSSFDETQHCDSPVPNFFDVNGIDSESDFSDVDLPPLPASEPPSASH
LVIESSRKQATLHVQRPPSFDSGMETQSTGTDREYADENTSAFVFPVPGKPLTLPRVPSE
EGPETCPKPPTPLWVTKMVQRQLSERDSHEAEKDQLKRKIVDLTAESEERAALLRDRDIS
YKIKEIEEIADLKYKLQEKEEALEEKCKLSKSLRMENTQLHAEFRDKNGQLTSLKAEVMR
LERLLRGSHSDDGQVAALREELEGKQKQLQDKKEEMNKMTNLNDVYRTKLDRREKDLAAK
EQELEQKNSELQKLRHEVGGLEQQKKIAQTSADSKYNELAGKYEALKQEFQAKCLELDST
LEELKSLKKKYEDLKNKLKDLEKIRDERDIILGKLQALEAALKLKADQEQKLFEELAMLT
RKLEDYEKLNTTRDGIEESFREIKNNYDDMEHKKREAELAVAPLKAKVSRLVKKCKERDE
LIKKLTNELRQQHKGHPNELLEAVTKLQSRMPDEEYNEPMSPYSTTLHGIHEVSEVTREN
SDVGVESSPSLSSLYTRRTPTLPTRMINELSEPLWQTIESSSPATVGRHQQPQLDVDNIQ
DTDEAAMQELLRSLSSDPIGSSSNRSTSSQVAATLPQTSATTRDRKSPGSALQELLTVDP
ELARMLDRGSNMGDGRDSGDMLQGTGSSERPRSSTPRRQRPRDSSHLRQSPEEILRLHSR
LSETRSNPYEFNYEPSPSLAEEASQLEQLHNINSPMFIDGVPIATSPRLSMSLPQPVSSQ
PLSSKNLPQLSAPTLLSMGVQPTQNIGSVPAAFSSIPGTHNGNIPSSANGGVPTYLRGAG
LDRPDLGSLSLSNSSMLSPAGLPTAALLPPTLACKSEGPPLSPSDFCISRIVSSRSVLLT
WVPPAMDEMAKSNGAQVAGYRVYLNNKQKQLVNSAHLTKALIENIDIRIPVTFSIETVSV
TGQTSHRVEMQFDGNMLSPFLTESMASESAADTEVSSIFSDFEEPQKRTFMAIYDYIPAD
HSPNDYPAFELQFNEGDIITIYGPPRPDGFYHGKLHGKKGLVPSNFIEEIHVSGNKGRKK
KKSRSQGSLHNGHSSTASDSPRQRSGRNNRPPPGKNSLGGSRV
Download sequence
Identical sequences Sakowv30046106m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]