SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Sakowv30046110m from Saccoglossus kowalevskii v3.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Sakowv30046110m
Domain Number 1 Region: 2173-2382
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000333
Family Tropomyosin 0.00095
Further Details:      
 
Domain Number 2 Region: 2313-2541
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000981
Family Tropomyosin 0.0018
Further Details:      
 
Weak hits

Sequence:  Sakowv30046110m
Domain Number - Region: 959-1165
Classification Level Classification E-value
Superfamily Tropomyosin 0.00556
Family Tropomyosin 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Sakowv30046110m
Sequence length 2982
Sequence
MKMADTWERSSTPGICSPRSKSPPTSPRPGTPRSIPSPRPPALGRLTPEGKLKNADFTSE
RNKLNKIIEDLEHDKKRLENTCKTLNEENKKKISLSKLPIRRQESVGYGSRRSSSTDSSD
NSEAEKFKKIMDDNFKTITELKNQIIEKDRRLDLIQHRRRKARRRQSGILESPKGLEDEI
GLDTASITSSISQRSDNSISGEWDEFERAEMEGNYQQLSKEYLQLKKAYTQLQAMVGGSL
DVQREFKLREQLELDLLDSQAKIEDFQKVIKDQGKDAGWVEEKQKFITYNRNLQSKVEEK
EDAIKKVKRDLNDSRDQNELLEFRILELEERSESSHTAVPESLSSLSPSSPNTIVRRSPS
PAALPLIQVTETDGISLQIAVNETGFTDMSVVDIKQKLEDIANNKDDDRLSVEDKKSLLQ
ARAMLDIADLKLKKMTSSETSLKRKVMDLEHEKDRLAAKVSSTEVELRSNLNVLDDCNKK
IDELEEIIEDRKKSESKFHAMEDVYLKNESKLKDEIKLLKKQMSSDKEGRDYENELLFQK
IAEVRDEKQTELLPQKVAILEESNSALQEKLDRVSDSSLQSKLDSLVKEDTLAAKEGAES
KQIELKSVMTLEELQHLKAKVDEIKAAHQKIAEMEQTELVLRKHIEALEREIVELQENIQ
HHESSYNEKVEEYEIREHTLKEISRKAEQAEVQLKEQLDASISEDSKKGEQIQELCLKIK
ILESSETSSKQKFDSDAINQNLDTELKQLKSENEKLSNQLNSYELAEKELKGQINQIKVE
NDVLKDKLQLLEIENPNLKSLPGDKTDDDKENGDVLKMKDRIWELESSEKVLEADLFDLK
EENEKLKSKLMNGDSEPMHSEIEVSETQEQTINDLRTSQTSLKEALSKTTSEKENLLKMY
QDALEKLQELETDEKIDQSPSLDVTSEAQVQSSVEQPIERVTVENVSMPQNLLLNMDSQK
EQSYADRVYELQASENVLKNIVKDLQVSEEELNNKIVELTSEKAELVAQLRDANLKDEES
EKVIKEHENEVSMLKMKIGEIETTKEKLEEESALLTRQLEVANQKLQEVEEKNAEVNKLN
NDLQVSEAQMKEEMLEMSSEKEEIEVKLLEAREELKKTNERIDNLTASESNLSEQLNNVI
TEKETLAADLKESNVRLVNQEQRLESVIAAAGEEKVKVLTKENDELTQKLEEAENRIEEQ
DIQETVLKKIINELEDSEKTSRERIVELEESGKTVKAALDGQEKTSEDLREKLDEVEKSE
KELQEKVLQLENSDKDLRDKLSELESAQLDSSNNEALMKEIKELELEVQRRKDIEVDLKE
DHFEELTSLQEQIQDLERTNQELRKKLAELSEELECIDELKKEHLSEVSNLQGKIKDLEN
QNAEDSNKFEDLKQSLSMEIATLKEQVDDLENSERDIRSKLSQNSDALFKSQKSYEEDQK
MWNEKEHHLKDQLSESEVVIKTLNEKVQALQQQEVTLKKEVEKQEEIKVKASEREIATYS
LQERIAELQECESLLKAKIIELTESEESAKKNYQETLKDRIENEKAWKVKIKDLEDTEDK
SRLRLQEMEVVEIDLREQLEAKVRENEVASEMWRQSEDLLNERVAELEELETVLKQRIQE
LEDNESHLKQEIKQKTKETENTWKQAAESSTLAYQERIHELEELEGDLKDRISQLAEAER
TAKDMLQEATVVYRENEEALKERIEQLEEDQGEMQGQIHALENLKAMMRGQIEDAEQHNK
ETQKANKRLQEKIEQFESGEQAHKDELNRMKKQLETTEQAEKESQKLLSQQLEDIQTESK
SNEKNLRDRVKELEYSDNELQNKLYETETVKTELEDRLESAEIENKRVKESNNHLKEQID
ELEEENSKLRRDLEDTQEKADESERISSELKDRLHETESVGDMKKMEEQKSLEKIQKQIE
ELQMSEEMLKDDVEHLERSERKLKQKLTEKNADIDKLYQQRKVEKDEMRSRILDLEMSEM
KLKEQVHVLDMEVKKKTWDIERIQPQIKFQTEQIDTVGKQEIKHKELANCLRKKVEQLEQ
REKDLKNDIMMASDSQSPLKEKLSRSERRETELVKKVERLEKSEETLKAAVLSLEQAKDT
KTKKEIEELNEQVQQLEDVADKLRHDLKRSENSEKSIKKLHTALEDDFSYLKEEESKLRN
RLKDIEKEKGQSKKRYDEDYEELQDKVIALEKVEQTLKKKLESSKKTEEALQKELNTAEE
MFDKTENTLKQTNKALERKLKQLEEAIDRSQLREKELETSGNSLQQKLKMLEKSECALKD
QVSELENQELNFKHQVRELESAERMLKMDNDQLKLEKDLLTDKMDDVKKSESDLQKKTGE
LQMNEKKLKEKVVALEKQLNVLREKVKEMETSAATMETRCAQASKLEKELSDTQDELQES
HTKIDQLERAKASLKRQLENLEDDLATGQMITLPLEEYKRMKAQTGLLEMTEQSVEDLEK
TEAKLQDKLKKMEEQKDYCDADKEILNLRLQLDEKNEINKELQDKFDESQIHLKTAQRQG
ADLRNIHSAVKKELNELKESLENGDILSGIYTKRNSKSTQTDALRYLGGTALQSRVYTPE
NKQTTLLEFLETLPYNAQIPKTTVEYPKSVLPELKLDNIADRLMLCTSKGLVDVDSKPGY
FMQSATLQMEKTADLDKIRLIEELVEHLPQYETNTAQVKTSPPRRLYAVREMTRRTTIPD
KSMPSPRALDTSRPYERKKLIEALVAVLPQGDPELPSEWIRPKTVQYGKLVDEPQMCANG
VFRAEFNTDIVVSQPSPPPLPDTMPPPIQFQTLPSSFDETQHCDSPVPNFFDVNGIDSES
DFSDVDLPPLPASEPPSASHLVIESSRKQATLHVQRPPSFDSGMETQSTGTDREYADENT
SAFVFPVPGKPLTLPRVPSEEGPETCPKPPTPLWVTKMVQRQLSERDSHEAEKDQLKRKI
VDLTAESEVKCLVTTYFYQVVNLDELPRMVIPTSHGLLVFYY
Download sequence
Identical sequences Sakowv30046110m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]