SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Serla_S7_9|373530|fgenesh2_pm.13_#_304 from Serpula lacrymans var. lacrymans S7.9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Serla_S7_9|373530|fgenesh2_pm.13_#_304
Domain Number 1 Region: 47-469
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 2.62e-121
Family ArgJ-like 0.00000266
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Serla_S7_9|373530|fgenesh2_pm.13_#_304
Sequence length 472
Sequence
MPVMQHYRAALALSSSDDAGRFASTITIKPAPSKSHLHASIPDSSFPKNFVVAGSHCGVK
KNAGVNDLAVILSTSSRPAAAAACFTRNAFKAAPVLVSQEVLEKGAGRARALVVNSGCAN
AVTGKQGMEDAWAMVKATDALLEPSSPSSSGTHETLVMSTGVIGQNLPISKIIAGIESKA
LTLDSNFSAWESAAKAFMTTDTFPKLRARTFTINGQTFRMAGIDKGAGMIHPDMGPPASA
KQLHATLLACILTDAAISPRSLQSALTYAVDRSFNSISVDGEMSTNDTIIVLANGAAADQ
SAKEIDEEHDRKAYETFREELTSFATDLAQLVVRDGEGATKFVTVNVQGASSFSDAHRVA
SKISTSALVKTALYGEDANWGRVLAASGSVQLSIPLDPTRVSVTFVPADGSTPLPVLVEG
EPEQVDEVRAKEILSEEDFEIKVELGLGKESAKYWTCDFSYEYVSINGDYRS
Download sequence
Identical sequences F8P8V8 F8Q9S5
XP_007322830.1.27812 jgi|Serla_S7_9|373530|fgenesh2_pm.13_#_304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]