SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Serla_S7_9|395536|fgenesh2_kg.10_#_903_#_2040_1_CFPN from Serpula lacrymans var. lacrymans S7.9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Serla_S7_9|395536|fgenesh2_kg.10_#_903_#_2040_1_CFPN
Domain Number 1 Region: 54-168
Classification Level Classification E-value
Superfamily DOPA-like 1.05e-35
Family DOPA dioxygenase-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Serla_S7_9|395536|fgenesh2_kg.10_#_903_#_2040_1_CFPN
Sequence length 173
Sequence
MSVEALLTNFSKDMTGEEIQALVLQAKGASVSTPTTTTTTPGARSVAYDAFQAPILPSTN
GFDFHIYHMQNIASEAKFARELHEKIIKEFPELRTYPLWEKPMGSHPTAMFEVDTFTPHQ
TGALFSWLVVNRGPCSVLVHPNTGNPLRDHTELATWIGKQWPLDTEILKSISA
Download sequence
Identical sequences F8P2L0 F8Q3U0
XP_007320933.1.27812 jgi|Serla_S7_9|395536|fgenesh2_kg.10_#_903_#_2040_1_CFPN

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]