SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Serla_S7_9|397468|fgenesh2_kg.11_#_1227_#_2402_1_CFPN from Serpula lacrymans var. lacrymans S7.9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Serla_S7_9|397468|fgenesh2_kg.11_#_1227_#_2402_1_CFPN
Domain Number 1 Region: 17-135
Classification Level Classification E-value
Superfamily DOPA-like 1.27e-32
Family DOPA dioxygenase-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Serla_S7_9|397468|fgenesh2_kg.11_#_1227_#_2402_1_CFPN
Sequence length 188
Sequence
MSRNLQESGPPTKLEDVLSSEIQEWHFHIYFHQRNAAEHHAALELRDAVLRLRRDGAFVA
VPLFRVNTDPIGPHPVGSYEIWVPASSFASVFSYLCLNRGELSILVHPLTREERTDHELR
RAWIGPSYPLDLSNLRRKTDEVPLQYPSLKLGYSSTSPPLTLEERRLLGANVERLLRSEK
EAARAPSN
Download sequence
Identical sequences F8P5L9 F8Q6X9
jgi|Serla_S7_9|397468|fgenesh2_kg.11_#_1227_#_2402_1_CFPN XP_007321692.1.27812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]