SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Serla_S7_9|438484|Genemark.6919_g from Serpula lacrymans var. lacrymans S7.9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Serla_S7_9|438484|Genemark.6919_g
Domain Number 1 Region: 96-153
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 3.66e-17
Family Cyanase C-terminal domain 0.00044
Further Details:      
 
Domain Number 2 Region: 14-91
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000000134
Family Cyanase N-terminal domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Serla_S7_9|438484|Genemark.6919_g
Sequence length 153
Sequence
MAQTAKVSANSAPYSNLPPISAALFEAKARKGLSFDAVAKAVGRDEVWVAAAFYGEAKLS
QEEINSLAIALDVPTVNIQDELGAHWWPSRGLGPIPPTDPTIYRLYEGVLAVVHEKFGDG
IMSMIDCKINVEKKPDPKGDRSSSGKFMPYAKW
Download sequence
Identical sequences F8NVP2
XP_007318899.1.27812 jgi|Serla_S7_9|438484|Genemark.6919_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]