SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Serla_S7_9|468807|estExt_fgenesh2_kg.C_71864 from Serpula lacrymans var. lacrymans S7.9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Serla_S7_9|468807|estExt_fgenesh2_kg.C_71864
Domain Number 1 Region: 95-163
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 7.72e-29
Family Cyanase C-terminal domain 0.00017
Further Details:      
 
Domain Number 2 Region: 16-75
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000000113
Family Cyanase N-terminal domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Serla_S7_9|468807|estExt_fgenesh2_kg.C_71864
Sequence length 163
Sequence
MAQAAKVPANSAPYADLPPISTALFEAKARKGLTFDDVAKAIGRDEIWVAAAFYGQAKLS
PDEIDSLAKVLDIPTVNIQNELGAHWWPSRGLGPVPPTDPVIYRLYESVLVYGHAIKAVV
HEKFGDGIMSMIDCKVNVEKKPDPKGDRVLLTFDGKFLPYAKW
Download sequence
Identical sequences F8NVP0 F8PWY7
jgi|Serla_S7_9|468807|estExt_fgenesh2_kg.C_71864 XP_007318897.1.27812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]