SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Serla_S7_9|471191|estExt_fgenesh2_kg.C_90216 from Serpula lacrymans var. lacrymans S7.9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Serla_S7_9|471191|estExt_fgenesh2_kg.C_90216
Domain Number 1 Region: 16-175
Classification Level Classification E-value
Superfamily CinA-like 1.96e-29
Family CinA-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Serla_S7_9|471191|estExt_fgenesh2_kg.C_90216
Sequence length 192
Sequence
MASASESYSFPPASFRPLLAEIATLLTSGSSPATLAVAETTSGGLISASLLSVPGASKWY
IGGATLYTTKSRSAWCGWSEQNIKDYRGATPEVVTGLATHVCNTLEAAYCIGESGATGPT
VPGKPFLHVAGRTYIAFVSRAGGVAVRMVDTGLADREKNMIAFTEAALQLIRDVLSGEAQ
LEYVEKEDETKL
Download sequence
Identical sequences F8P0U6 F8Q1W0
jgi|Serla_S7_9|471191|estExt_fgenesh2_kg.C_90216 XP_007320020.1.27812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]