SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Serla_S7_9|473110|estExt_fgenesh2_kg.C_100859 from Serpula lacrymans var. lacrymans S7.9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Serla_S7_9|473110|estExt_fgenesh2_kg.C_100859
Domain Number 1 Region: 44-156
Classification Level Classification E-value
Superfamily DOPA-like 2.35e-30
Family DOPA dioxygenase-like 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Serla_S7_9|473110|estExt_fgenesh2_kg.C_100859
Sequence length 164
Sequence
MTYESPLVGYENAELLPSTINPDGISLFNPPGPKSASYDEFPKPIDPSNGFDFHIYYTQG
VPSETKYARELHERVRREFPELRIHELLDWPVPPHLTTTFEVNTSNPHQTGALFCWFVVH
RGPCSVLIHPHTGNPLRDHTELATWIGKPWPVDVDIIKKHSPSD
Download sequence
Identical sequences F8P2I9 F8Q3R3
jgi|Serla_S7_9|473110|estExt_fgenesh2_kg.C_100859 XP_007320912.1.27812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]