SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Serla_S7_9|473115|estExt_fgenesh2_kg.C_100864 from Serpula lacrymans var. lacrymans S7.9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Serla_S7_9|473115|estExt_fgenesh2_kg.C_100864
Domain Number 1 Region: 45-158
Classification Level Classification E-value
Superfamily DOPA-like 5.49e-39
Family DOPA dioxygenase-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Serla_S7_9|473115|estExt_fgenesh2_kg.C_100864
Sequence length 161
Sequence
MTYDSPLVGFENAEPLPSTINPDGKSLFNPPGPKSGSYDEFPKPIDSSNNGFDFHIYYMQ
AIPTETKYARELHERVRREFPELRIYRFWDKPVGPHPTAMFEVNTFNPHQTGAFFSWLVV
NRGPCSVLIHPNTGDSLRDHTELATWIGKQWPLHTDMLKRH
Download sequence
Identical sequences F8P2J1 F8Q3R5
XP_007320914.1.27812 jgi|Serla_S7_9|473115|estExt_fgenesh2_kg.C_100864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]