SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Serla_S7_9|448229|estExt_fgenesh2_pm.C_60126 from Serpula lacrymans var. lacrymans S7.9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Serla_S7_9|448229|estExt_fgenesh2_pm.C_60126
Domain Number 1 Region: 4-373
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 2.43e-92
Family IF2B-like 0.00000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Serla_S7_9|448229|estExt_fgenesh2_pm.C_60126
Sequence length 386
Sequence
MAPMTSIRLSGDKIEIVNQLLLPHTTEFIEIQTIEQAHDAIKSMKIRGAPAIASLAALSF
GAYLSRGLEASPAPEYLASPEALRDHVLPILDFLITARPTAVNLGAATRRLTKTLQSSID
AGKDPRSIVLVLIAESHLVADEDVGRNKEMSKWGGEWLIDQVKQAGGDGTSLNVLTVCNT
GSLATSGYGTALGLITYLHEVGNLGKAYYTQTAPYHQGSRLTALELKTLQIPSVMICDTM
VGSLFQHHKIHAVAVGADRVAKNGDTANKIGTYNAAVLAARHKIPFIVVAPISTVDLDVA
DGSGIPIEHRPPLEACIVRGALHPPTLNAQGQKEQAQVMITPTDLYEIYNPSFDVTPAEL
ITAIVTEKGVAVKKEGSQIFDLSAIV
Download sequence
Identical sequences F8NUL4 F8PUF2
XP_007317356.1.27812 jgi|Serla_S7_9|448229|estExt_fgenesh2_pm.C_60126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]