SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Serla_S7_9|478574|estExt_fgenesh2_kg.C_150632 from Serpula lacrymans var. lacrymans S7.9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Serla_S7_9|478574|estExt_fgenesh2_kg.C_150632
Domain Number 1 Region: 152-276
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 3.84e-35
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.0000169
Further Details:      
 
Domain Number 2 Region: 47-150
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.06e-29
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Serla_S7_9|478574|estExt_fgenesh2_kg.C_150632
Sequence length 279
Sequence
MQSVIKSSTLARARAFRTAQNVGGGVRSFASSARRSQAVPTEKPVLMKEFKIYRWNPDEP
AKKPTLQSYTIDLNQTGPMILDALIKIKNEIDPTLTFRRSCREGICGSCAMNIDGQNTLA
CLCRTDRNVGKDAKVYPLPHMYIVKDLVPDLTLFYKQYKSIQPYLQNDNPPASGEFLQSQ
EERKKLDGLYECILCACCSTSCPSYWWNQDEYLGPATLMQAYRWIADSRDSYGAERKEKL
QNEMSMYRCHTIFNCSRTCPKGLNPAAAIAKIKLELAAE
Download sequence
Identical sequences F8P9Z8 F8QBC7
XP_007323431.1.27812 jgi|Serla_S7_9|478574|estExt_fgenesh2_kg.C_150632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]