SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000011 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000011
Domain Number 1 Region: 347-488
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.56e-18
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 2 Region: 186-265,299-363
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000146
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 484-542
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000251
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 4 Region: 530-571
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000369
Family EGF-type module 0.025
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000000011
Domain Number - Region: 271-308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000113
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000011   Gene: ENSSSCG00000000010   Transcript: ENSSSCT00000000011
Sequence length 709
Comment pep:novel chromosome:Sscrofa10.2:5:1071720:1158793:-1 gene:ENSSSCG00000000010 transcript:ENSSSCT00000000011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERAAPSRRVPLPLLLLGGLSLLAAPAGAEVPMEACCTDGHQMATQHKDCSLPYTSESKE
CRMVQEQCCQNQLEELHCAAGISLADEGDSCAAPQGDNASLEAMIVKRCCHCCLLGRAAQ
AQGQSCEYNLMVGYQCGLVFRACCVKGQENADFAPGDIGDLQETAKVSEIEEEQEDPYLN
DRCRGGGPCKQQCRDTGQEVVCSCFVGYQLLPDGVSCEDINECIKGSQNCRLGETCINTV
GSFRCQRDSSCGTGYELTEDNDCKDVPDIDECESGIHNCLPDFICQNTLGSFRCRPKLQC
KSGFIQDALGNCIDINECLSISAPCPVGQTCINTEGSYTCQKNVPNCGRGYHLNEEGTRC
VDVDECSPPAEPCGPGHMCVNSLGSFRCECKAGYYFDGISRTCVDINECRRYPGRLCGHK
CENTPGSYYCSCTIGFRLSSDGRSCEDVNECHSSPCSQECANVYGSYQCYCRRGYQLSDV
DGTTCEDIDECALPTGGHICSYRCINIPGSFQCSCPSTGYRLAPNGRNCQDIDECVTGIH
NCSINETCFNIQGSFRCLAFECPENYRRSADTLRQEKTDTIRCIKSCRPNDVTCVLAPVH
TISHTVVSLPTFREFTRPEEIIFLRAVTPAHPANHADIIFDITDGNLRDSFDIIKRYMDG
MTVGVVRQVRPIVGPFHAVLKLEMNYVVGGVVSHRNVVNVHIFVSEYWF
Download sequence
Identical sequences 9823.ENSSSCP00000000011 ENSSSCP00000000011 ENSSSCP00000000011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]