SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000030 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000030
Domain Number 1 Region: 671-779
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-24
Family Spermadhesin, CUB domain 0.0022
Further Details:      
 
Domain Number 2 Region: 151-276
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.98e-19
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 114-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000477
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 530-668
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000005
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 45-88
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000649
Family EGF-type module 0.027
Further Details:      
 
Domain Number 6 Region: 5-42
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000633
Family EGF-type module 0.02
Further Details:      
 
Domain Number 7 Region: 487-573
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000659
Family Growth factor receptor domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000030   Gene: ENSSSCG00000000029   Transcript: ENSSSCT00000000030
Sequence length 857
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:3050693:3114315:1 gene:ENSSSCG00000000029 transcript:ENSSSCT00000000030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGMNCMNKDHGCAHICRETPKGGVACDCRPGFDLAQNQKDCTLTCNYGNGGCQHSCEDTD
TGPTCGCHQKYALHSDGRTCIEKDEAAIERSQFNATSVADVDKRVKRRLLMETCAVNNGG
CDRTCKDTATGVRCSCPVGFTLQPDGKTCKDINECLVNNGGCDHFCRNTVGSFECGCRKG
YKLLTDERTCQDIDECSFERTCDHVCINSPGSFQCLCHRGYTLYGTTHCGDVDECSMNNG
SCDQGCVNTKGSYECVCPPGRRLHWNQKDCVETGKCLSRAQASPQAQLACSKAAGVEVCS
LSCTTHTLFVPDSDNGYSLSCGVRGLQGKSPQKRNGTSSSTGPSCSGAPATLIRQKARFK
IRDAKCHLRPRPREPAKEAPRQLLLENCHVTFVTVKCDSSKKRRRGRKSPSKEVTHITAE
FEVEAKMEEASDTCEADCVRKRAEQSLQAAIKTLRKSIGRQQFSVQVAGTEYEVAQRPAR
ALESPGTCGTGQVLQDGKCVACEPGTYFSGEPGQCVPCAPGTYQDRDGQLSCTRCPSSDG
LGLAGARNVSECGGQCSPGFFSSDGFRPCQACPVGTYQPEPGRTGCFSCRGGLLTKHEGT
ASFQDCEAKVHCSPGHHYNTTTHRCIRCPVGTYQPEFGQNHCITCPGNTSTDFDGSTNVT
HCKNQHCGGELGDYTGYIESPNYPGDYPANAECVWQISPPPKRRILIVVPEIFLPIEDEC
GDVLVMRKSASPTSITTYETCQTYERPIAFTSRSRKLWIQFKSNEANSGKGFQVPYVTYD
EDYQQLIEDIVRDGRLYASENHQEILKDKKLIKALFDVLAHPQNYFKYTAQESKEMFPRS
FIKLLRSKVSRFLRPYK
Download sequence
Identical sequences ENSSSCP00000000030 ENSSSCP00000000030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]