SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000070 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000070
Domain Number 1 Region: 22-539
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 4.45e-168
Family Aconitase iron-sulfur domain 0.00000000000000194
Further Details:      
 
Domain Number 2 Region: 546-765
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 5.1e-65
Family LeuD-like 0.000000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000070   Gene: ENSSSCG00000000064   Transcript: ENSSSCT00000000070
Sequence length 770
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:4384587:4412842:-1 gene:ENSSSCG00000000064 transcript:ENSSSCT00000000070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKALGVRQYHVASVLCQRAKVAMSHFEPHEYIRYDLLEKNIDIVRKRLNRPLTLSEKIVY
GHLDDPANQEIERGKTYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPSTIHCDHLIE
AQLGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILENYAYPGVLLIGT
DSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWTSPKDVILKV
AGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHRMKKYLSKTG
RADIANLADEFKDHLVPDPGCHYDQVIEINLSELKPHINGPFTPDLAHPVAEVGSVAEKE
GWPLDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKSQFTITPGSEQIRATIERDG
YAQVLRDVGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDANPETHAFVT
SPEIVTALAIAGTLKFNPETDFLTGKDGKKFKLEAPDADELPRAEFDPGQDTYQHPPKDS
SGQRVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAAGPWLKFRGHLD
NISNNLLIGAINIENGKANSVRNAVTQEFGPVPDTARYYKQHGIRWVVIGDENYGEGSSR
EHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYNKIHPVDKLTIQGLKD
FAPGKPLKCIIKHPNGTQETILLNHTFNETQIEWFRAGSALNRMKELQQK
Download sequence
Identical sequences ENSSSCP00000000070 ENSSSCP00000000070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]