SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000129 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000129
Domain Number 1 Region: 6-134
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.01e-43
Family Galectin (animal S-lectin) 0.000000494
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000129   Gene: ENSSSCG00000000125   Transcript: ENSSSCT00000000131
Sequence length 135
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:7642312:7646221:-1 gene:ENSSSCG00000000125 transcript:ENSSSCT00000000131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACGLVASNLNLKPGECLKVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFDMHGDINTIV
CNSKDGGAWGAEQRESAFPFQPGSVVEVCISFGQTDLTIKLPDGYEFSFPNRLNLEAIEY
LAADGDFKIKCVAFE
Download sequence
Identical sequences A0A286ZRI5
9823.ENSSSCP00000000129 ENSSSCP00000000129 ENSSSCP00000000129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]