SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000197 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000197
Domain Number 1 Region: 44-198
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 1.02e-79
Family Hedgehog (development protein), N-terminal signaling domain 0.000000241
Further Details:      
 
Domain Number 2 Region: 203-349
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.57e-36
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000197   Gene: ENSSSCG00000000188   Transcript: ENSSSCT00000000199
Sequence length 400
Comment pep:known chromosome:Sscrofa10.2:5:15473753:15478514:-1 gene:ENSSSCG00000000188 transcript:ENSSSCT00000000199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAASMALPASLVPLCCLALLALPAQSCGPGRGPVGRRRYVRKQLVPLLYKQFVPSVPERT
LGASGPAEGRVTRGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMN
MWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYY
ESRNHVHVSVKADNSLAVRAGGCFPGNATVRLRSGERKGLRELHRGDWVLAADAAGRVVP
TPVLLFLDRDLQRRASFVAVETERPPRKLLLTPWHLVFAARGPAPAPGDFAPVFARRLRA
GDSVLAPGGDALRPARVARVAREEAVGVFAPLTAHGTLLVNDVLASCYAVLESHQWAHRA
FAPLRLLHALGALLPGGAVQPTGMHWYSRFLYRLAEELLD
Download sequence
Identical sequences ENSSSCP00000000197 ENSSSCP00000000197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]