SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000272 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000272
Domain Number 1 Region: 147-391
Classification Level Classification E-value
Superfamily vWA-like 1.11e-81
Family Integrin A (or I) domain 0.000000259
Further Details:      
 
Domain Number 2 Region: 386-483
Classification Level Classification E-value
Superfamily Integrin domains 2.72e-22
Family Integrin domains 0.0045
Further Details:      
 
Domain Number 3 Region: 646-716
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000863
Family Integrin beta tail domain 0.0079
Further Details:      
 
Domain Number 4 Region: 44-99
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000167
Family Plexin repeat 0.0016
Further Details:      
 
Domain Number 5 Region: 562-600
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000142
Family Integrin beta EGF-like domains 0.0065
Further Details:      
 
Domain Number 6 Region: 605-643
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family Integrin beta EGF-like domains 0.01
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000000272
Domain Number - Region: 533-563
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00949
Family Integrin beta EGF-like domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000272   Gene: ENSSSCG00000000257   Transcript: ENSSSCT00000000276
Sequence length 800
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:18830224:18839919:-1 gene:ENSSSCG00000000257 transcript:ENSSSCT00000000276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALSIVLVFLLALSRGESELDAKTSSPQEATQRGSPDLSLPGSCQPAPSCQKCILSHPS
CAWCKQLNFTASGEAEARRCASREELLARGCPPEELEEPRGRQEVLQDEPLSQDTRGEGA
TQLAPQRVRVTLRLGEPQQLRVRFRRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
RLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLERCQPPFSFRHVLSLTGDAK
AFEQEVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGHCHLDSDGLYSRSPEFDYPSVGQVAQALSAANIQPIFAVTSATLPVYQELS
KLIPKSAVGELSEDSSNVVQLIMDAYNRLSSTVTLEHEHALLPSGVHISYESQCGDPEKR
QGETGDRGQCNHVRINQTVNFLVTLQATHCLTEPHLLRFRARGFSEELTVELHTLCDCNC
NDTQLQAPHCSDGLGHLQCGVCSCVPGRLGRLCECSEAELSSPDLESGCRASNGTGPLCS
GRGRCQCGRCTCSGQSSGRLCECDDASCERHEGILCGGFGHCQCGVCHCHANRTGRACEC
SGDMDGCVSPEGGLCNGHGHCKCNRCECFAGYYGALCDQCSGCKTPCERHRDCAECKAFG
TGPLATNCSVDCARANVTLALAPILDDSWCKERTQDNQLFFFLIEDEAGSMVMLRVRPPE
KGADHTQIIVLSCVGGIVAVGLGLVLAYRLSVEIYDRREYRRFEKEQQQLKWKQNKNPLY
KSAITTTVNPRFQQADSPTL
Download sequence
Identical sequences F1SGE7
XP_003355464.2.46622 XP_005652617.1.46622 XP_005652618.1.46622 XP_013841173.1.46622 ENSSSCP00000000272 ENSSSCP00000000272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]