SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000276 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000276
Domain Number 1 Region: 145-234
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 7.06e-26
Family Thyroglobulin type-1 domain 0.00000859
Further Details:      
 
Domain Number 2 Region: 63-105
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000018
Family Growth factor receptor domain 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000276   Gene: ENSSSCG00000000261   Transcript: ENSSSCT00000000280
Sequence length 238
Comment pep:known chromosome:Sscrofa10.2:5:18768002:18772057:1 gene:ENSSSCG00000000261 transcript:ENSSSCT00000000280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPHRLLPPLLLTLLLAARPGGALAQCPGCGQGVQTGCPGGCAEEEDGGPPTEGCAEAGG
CLRREGQQCGVYTPNCAPGLQCQPPEEDQAPLRALLLGRGRCRRARTPSAVGENPKESKP
QAGTTRSQDVNRRDPQKSPGTSTTPSRPNPGGVQDTEMGPCRRHLDSVLQQLQTEVFRGA
HTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGQPLAGSPDGDGNAPCPSGSSG
Download sequence
Identical sequences ENSSSCP00000000276 ENSSSCP00000000276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]