SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000277 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000277
Domain Number 1 Region: 244-335,399-435
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-16
Family SPRY domain 0.035
Further Details:      
 
Domain Number 2 Region: 49-199
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000178
Family SPRY domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000277   Gene: ENSSSCG00000000262   Transcript: ENSSSCT00000000281
Sequence length 442
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:18884026:18901724:1 gene:ENSSSCG00000000262 transcript:ENSSSCT00000000281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRTRRPRFVLMNKMDDLNLHYRFLNWRRRIREIREVRAFRYQERFKHILVDGDTLSYHG
NSGEVGCYVASRPLTKDSNYFEVSIVDSGVRGTIAVGLVPQYYSLDHQPGWLPDSVAYHA
DDGKLYNGRAKGRQFGSKCNSGDRIGCGIEPVSFDVQTAQIFFTKNGKRVGSTIMPMSPD
GLFPAVGMHSLGEEVRLHLNAELGREDDSIMMVDSYEDEWGRLHDVRVCGTLLEYLGKGK
SIVDVGLAQARHPLSTRSHYFEVEIVDPGEKCYIALGLARKDYPKNRHPGWSRGSVAYHA
DDGKIFHGSGVGDPFGPRCYKGDIMGCGIMFPRDYILDSEGDSDDSCDTVILSPTARAVR
NVRNVMYLHQEGEEEEEEEEEEDDGEEIEQEHEGKKVVVFFTRNGKIIVKKDAVVPSGGF
FPTIGMLSCGEKVKVDLHPLSG
Download sequence
Identical sequences ENSSSCP00000000277 ENSSSCP00000000277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]