SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000451 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000451
Domain Number 1 Region: 293-556
Classification Level Classification E-value
Superfamily YWTD domain 1.09e-55
Family YWTD domain 0.00000221
Further Details:      
 
Domain Number 2 Region: 1140-1414
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-43
Family YWTD domain 0.00000572
Further Details:      
 
Domain Number 3 Region: 839-878
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000131
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 4 Region: 880-916
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000851
Family LDL receptor-like module 0.00047
Further Details:      
 
Domain Number 5 Region: 922-967
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000106
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 6 Region: 638-682
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 720-755
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 8 Region: 680-718
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 9 Region: 181-285,549-610
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000675
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 10 Region: 601-636
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000772
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 11 Region: 1010-1045
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 12 Region: 757-792
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000011
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 13 Region: 27-62
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000314
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 14 Region: 1054-1100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000288
Family EGF-type module 0.052
Further Details:      
 
Domain Number 15 Region: 964-1000
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000746
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 16 Region: 1-25
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000115
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 17 Region: 1466-1501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000144
Family EGF-type module 0.042
Further Details:      
 
Domain Number 18 Region: 1093-1129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000492
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 19 Region: 1505-1539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000939
Family EGF-type module 0.031
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000000451
Domain Number - Region: 1541-1575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000921
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 1645-1683
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00108
Family EGF-type module 0.059
Further Details:      
 
Domain Number - Region: 1576-1611
Classification Level Classification E-value
Superfamily EGF/Laminin 0.011
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 1422-1454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0174
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000451   Gene: ENSSSCG00000000423   Transcript: ENSSSCT00000000457
Sequence length 1813
Comment pep:novel chromosome:Sscrofa10.2:5:24316944:24353178:1 gene:ENSSSCG00000000423 transcript:ENSSSCT00000000457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCISKAWVCDGDSDCEDNSDEENCESLACRPPSHPCANNTSVCLPPDKLCDGNDDCGDGS
DEGLWVGSMGRGAGEEEDFLTPTHRPIATQPSHILCVHPRRCRPGSGIRPHCRPSLEQHP
PAGGHQFFCFLDRCCPSRRAERGGQNRCHCRSPSPPWHMFCSPSPQQKCNASSQFLCSGR
CVAEALLCNGQDDCGDGSDERGCHVNECLSHKLSGCSQDCEDLKIGFKCRCRPGFRLKDD
GRTCADVDECSTTFPCSQRCINTHGSYKCLCVEGYAPRGGDPHSCKAVTDEEPFLIFANR
YYLRKLNLDGSNYTLLKQGLNNAVALDFDYREQMIYWTDVTTQGSMIRRMHLNGSNVQVL
HRTGLSNPDGLAVDWVGGNLYWCDKGRDTIEVSKLNGAYRTVLVSSGLREPRALVVDVQN
GYLYWTDWGDHSLIGRIGMDGSGRSVIVDTKITWPNGLTLDYVTERIYWADAREDYIEFA
SLDGSNRHVAPPATVLSQDIPHIFALTLFEDYVYWTDWETKSINRAHKTTGTNKTLLIST
LHRPMDLHVFHALRQPDVPNHPCKVNNGGCSNLCLLSPGGGHKCACPTNFYLGGDGRNCV
SNCTASQFVCKNDKCIPFWWKCDTEDDCGDHSDEPPDCPEFKCRPGQFQCSTGICTNPAF
ICDGDNDCQDNSDEANCDIHVCLPSQFKCTNTNRCIPGIFRCNGQDNCGDGEDERDCPEV
TCAPNQFQCSITKRCIPRVWVCDRDNDCVDGSDEPANCTQMTCGVDEFRCKDSGRCIPAR
WKCDGEDDCGDGCFSPCSHCPLGVAESPVAFRDTGTRDALKGRVPKPTLLGLSLPYLPPA
PRPCSESEFSCANGRCIAGRWKCDGDHDCADGSDEKDCTPRCDMDQFQCKSGHCIPLRWR
CDADADCMDGSDEEACSTGVRTCPLDEFQCNNTLCKPLAWKCDGEDDCGDNSDENPEECA
RFVCPPNRPFRCKNDRVCLWIGRQCDGTDNCGDGTDEEDCEPPTAQSPHCKDKKEFLCRN
QRCLSSSLRCNMFDDCGDGSDEEDCSIDPKLTSCATNASICGDEARCVRTEKAAYCACRS
GFHTVPGQPGCQDINECLRFGTCSQLCNNTKGGHLCSCARNFMKTHNTCKAEGSEYQVLY
IADDNEIRSLFPSHPHSAYEQAFQGDESVRIDAMDVHVKAGRVYWTNWHTGTISFRSLPP
AAPPTTSNRHRRQIDRGVTHLNISGLKMPRGIAIDWVAGNVYWTDSGRDVIEVAQMKGEN
RKTLISGMIDEPHAIVVDPLRGTMYWSDWGNHPKIETAAMDGTLRETLVQDNIQWPTGRA
VDYHNERLYWADAKLSVIGSIRLNGTDPIVAADSKRGLSHPFSIDVFEDYIYGVTYINNR
VFKIHKFGHSPLINLTGGLSHASDVVLYHQHKQPEVTNPCDRKKCEWLCLLSPSGPVCTC
PNGKRLDNGTCVAVPSPTLPPDAPRPGTCNLQCFNGGSCFLNARRQPKCRCQPRYTGDKC
ELDQCWEYCRNGGTCAASPSGMPTCRCPTGFTGPKCTQQVCAGHCANNSTCTVNQGNQPQ
CRCLPGFLGDRCQYRQCSGYCENFGTCQMAADGSRQCRCTAYFEGARCEVNKCSRCLDGA
CVVNKQSGDVTCNCSDGRVAPSCLTCVGHCSNGGSCTMNSKMMPECQCPPHMAGPRCEEQ
VVSPQQPGHMASILIPLLLLLLMLLVAGVVFWYKRRVRGAKGFQHQRMTNGAMNVEIGNP
TYKMYEGGEPDDVGGLLDPEFALDPDKPTNFTNPVYATLYMGGHGSRHSLASTDEKRELL
GRGPEDEIGDPLA
Download sequence
Identical sequences ENSSSCP00000000451 ENSSSCP00000000451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]