SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000486 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000486
Domain Number 1 Region: 287-475,786-933
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.91e-116
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.000000573
Further Details:      
 
Domain Number 2 Region: 6-120
Classification Level Classification E-value
Superfamily DUSP-like 1.44e-36
Family DUSP, domain in ubiquitin-specific proteases 0.00000041
Further Details:      
 
Domain Number 3 Region: 501-602
Classification Level Classification E-value
Superfamily EPT/RTPC-like 0.0000000464
Family RNA 3'-terminal phosphate cyclase, RPTC 0.024
Further Details:      
 
Domain Number 4 Region: 147-218
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000679
Family UBX domain 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000486   Gene: ENSSSCG00000000457   Transcript: ENSSSCT00000000493
Sequence length 982
Comment pep:known chromosome:Sscrofa10.2:5:29581112:29800775:1 gene:ENSSSCG00000000457 transcript:ENSSSCT00000000493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGGAADLDIQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNV
YPGPIDNSGLLKADGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVE
QGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFNIPDEKETRL
WNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGPSTPKSPGASNFSTLP
KISPSSLSNNYNNINNRNVKNSNYCLPSYTAYKNYDYSEPGRNNEQPGLCGLSNLGNTCF
MNSAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQMWSGKFSYVTP
RAFKTQVGRFAPQFSGYQQQDCQELLAFLLDGLHEDLNRIRKKPYIQLKDADGRPDKVVA
EEAWENHLKRNDSIIVDIFHGLFKSTLVCPECAKISVTFDPFCYLTLPLPMKKERTLEVY
LVRMDPLTKPMQYKVVVPKIGNILDLCTALSTLSGVPADKMIVTDIYNHRFHRIFAMDEN
LSSIMERDDIYVFEININRTEDTEHVIIPVCLREKFRHSSYTHHTGSSLFGQPFLMAVPR
NNTEDKLYNLLLVRMCRYVKISTETEETEGSLHCCKDQNINGNGPNGIHEEGSPSEMETD
EPDDESSQDQELPSENENSQSEDSVGGDNDSENGLCTEETCKGQLTGHKKRLFTFQFNNL
GNTDINYIKDDTRHIRFDDRQLRLDERSFLALDWDPDLKKRYFDENAAEDFEKHESVEYK
PPKKPFVKLKDCIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDLWSLPPVLVVHLKRFS
YSRYMRDKLDTLVDFPINDLDMSEFLINPNAGPCRYNLIAVSNHYGGMGGGHYTAFAKNK
DDGKWYYFDDSSVSTASEDQIVSKAAYVLFYQRQDTFSGTGFFPLDRETKGASAATGIPL
ESDEDSNDNDNDIENENCMHTN
Download sequence
Identical sequences ENSSSCP00000000486 ENSSSCP00000000486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]