SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000500 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000500
Domain Number 1 Region: 10-53
Classification Level Classification E-value
Superfamily LEM domain 0.000000000000412
Family LEM domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000500   Gene: ENSSSCG00000000469   Transcript: ENSSSCT00000000507
Sequence length 748
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:32769687:32836097:1 gene:ENSSSCG00000000469 transcript:ENSSSCT00000000507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAASAPQQLSDEELFSQLRRYGLSPGPVTESTRPVYLKKLKKLREEEQQQHRSGGRG
TKTRNSNNNNTAAATVAAAGSTVAAAGMGVRPVSGDLSYLRTPGGLGRISTSGPESPLGG
TGGASAAPTAGSKVVLGFSSDESDVEASPRDQAGGGGGRKDRAPLQYRGLKPPSAPLTAS
EVTNNNSAERRKPHSWWGARRSAAPELQSPSGRDGAAEDEEQEGEDGEDRDPEAEEPLWS
GRTVNGSRLLPYSCRENYSDSEEEDDDDVASSRQVLKDDSLSRHRLRRGHSKPLSPLPAK
SAGGRLETSVQGRGGIAMNDRAAAAGSLDRSRNLEEPAAAEQGGGCDPLDSSPIPRYRVN
AKKLAPLLPPPLADMDSTLDSSTGSLLKTNNHIGGGAFNVDSPRIFSNSLPPGAAVAASG
SLRINHSNHTGSNHTYLKNTYNKPKLSEPEEELLQQFKREEVSPTGGFSAHYLSMFLLTA
ACLFFLILGLTYLGMRGTGVTEDGELTIKNPFDETFGKIQESQKNLMMNTLYKLHDRLAQ
LAGDHECGSSSQRTLSVQEAAAYLKDLGPEYEDIFNISLQWIFENGKDVGIRCVGYDPEE
ELTDMVDVQFLQSTRPQMSFWCRFRRAFITVTHRLLLLCLGVVMVCVVLRYMKYRWTKEE
EETRQMYDMVVKIIDVLRSHNEACQENKDLQPYMPIPHVRDSLIQPHDRKKMKKVWDRAV
DFLAANESRVRTETRRIGGTDFLVWRWI
Download sequence
Identical sequences ENSSSCP00000000500 ENSSSCP00000000500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]