SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000645 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000645
Domain Number 1 Region: 322-427,549-665
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.92e-56
Family Phosphate binding protein-like 0.0000000402
Further Details:      
 
Domain Number 2 Region: 2-247
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.41e-23
Family L-arabinose binding protein-like 0.008
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000000645
Domain Number - Region: 490-522
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0432
Family Voltage-gated potassium channels 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000645   Gene: ENSSSCG00000000614   Transcript: ENSSSCT00000000660
Sequence length 1351
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:62070371:62272186:1 gene:ENSSSCG00000000614 transcript:ENSSSCT00000000660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISDKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQDFVNKIRSTIENS
FVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEEATYIFEVANSVGLTGYG
YTWIVPSLVAGDTDTVPSEFPTGLISVSYDEWDYGLPARVRDGIAIITTAASDMLSEHSF
IPEPKSSCYNTHEKRIYQSNMLNRYLINVTFEGRNLSFSEDGYQMHPKLVIILLNKERKW
ERVGKWKDKSLQMKYYVWPRMCPETEEQEDDHLSIVTLEEAPFVIVESVDPLSGTCMRNT
VPCQKRIVSENKTDEEPGYIKKCCKGFCIDILKKISKSVKFTYDLYLVTNGKHGKKINGT
WNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSRSNGTVSPSAFLEP
FSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSFTIGKAIWLLWGLV
FNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYVDQVSGLSDKKFQR
PNDFSPPFRFGTVPNGSTERNIRNNYAEMHAYMGKFNQRGVDDALLSLKTGKLDAFIYDA
AVLNYMAGRDEGCKLVTIGSGKVFASTGYGIAIQKDSGWKRQVDLAILQLFGDGEMEELE
ALWLTGICHNEKNEVMSSQLDIDNMAGVFYMLGAAMALSLITFICEHLFYWQFRHCFMGV
CSGKPGMVFSISRGIYSCIHGVAIEERQSVMNSPTATMNNTHSNILRLLRTAKNMANLSG
VNGSPQSALDFIRRESSVYDISEHRRSFTHSDCKSYNNPPCEENLFSDYISEVERTFGNL
QLKDSNVYQDHYHHHHRPHSIGSTSSIDGLYDCDNPPFTTQPRSLGKKPLDIGLPSSKHS
QLSDLYGKFSFKSDRYSGHDDLIRSDVSDISTHTVTYGNIEGNAAKRRKQQYKDSLKKRP
ASAKSRREFDEIELAYRRRPPRSPDHKRYFRDKEGLRDFYLDQFRTKENSPHWEHVDLTD
IYKERGEDFKRDSVGGGGPCTNRSHLKHGTGDKHGVVGGVPAPWEKNLTNVDWEERSGGN
FCRSCPSKLHNYSATVAGQNSGRQACIRCEACKKAGNLYDISEDNSLQELDQPAAPVAVT
SNASTTKYPQSPTNSKAQKKTRNKLRRQHSYDTFVDLQKEEAALAPRSVSLKDKGRFLDG
SPYAHMFEMPASESTFGNGKAAAPAAGHHHHSNPGGGYMLSKSLYPDRVTQNPFIPTFGD
DQCLLHGSKSYFFRQPTVAGAPKARPDFRALVTNKPVVSALHGAVPGRFQKDICIGNQSN
PCVPNNKNPRAFNGSSNGHVYEKLSSIESDV
Download sequence
Identical sequences ENSSSCP00000000645 ENSSSCP00000000645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]