SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000650 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000650
Domain Number 1 Region: 121-319,379-472
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000589
Family Quinoprotein alcohol dehydrogenase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000650   Gene: ENSSSCG00000000619   Transcript: ENSSSCT00000000665
Sequence length 619
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:62761449:62827041:-1 gene:ENSSSCG00000000619 transcript:ENSSSCT00000000665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVWPSVFSGKKSPDLGEYDPLTQADSDESEDDLVLNLQQKNGGVKNGQSPLGEAPEPDSD
AEPAGSAKPHLSEVTTEGYPLEPLGGLEQKAASSMASYVRTSVFLLMLVVSTVLVLVCAF
LIPCPPRDLHSTWSRRLGPQGGGDLNPLELADVNGDGLRDVLLSFVTLRNGSTAGVSRPP
ALLVCLSGMNGSTLWSSPLPEEARDVTCLDLMPGSGAGTVCLVTGTHKMLSAFNGTSGKA
IWTLNPNYLSNGTLAAPGVMLPDLDEDGVRDLVVLAIGEVQPDLCFLLVSGRTGSPVGRP
VKYSIVGVGNLIGPQVYITASGAVYILFGFGNIQAVALRDIFVQAQNRDSSPPSLQIEEP
EWEKRRSINLSELIDVYSDGVELLQMVKAADSNCSNLLITTRQGLVLLRGQNLTPSWTLS
LQGLRSQPTPGYFTDDETLDFLLQIPSGTGMKKVMVVDGDSGLVTWSYSVPCRMRETPTT
SAATVDQKSVFLFWAEGLSAPSPSSDVTLGTEAPDLHHLYLLHPAFPSILLDLANATGTV
TASEVGINDLWKDAFYVTRTTGPSSEGHPAPLVVSKLSLRWALMEGQVVQLKETTPKIGR
GELRRFLSRIKFVDSPYQM
Download sequence
Identical sequences ENSSSCP00000000650 ENSSSCP00000000650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]