SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000712 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000712
Domain Number 1 Region: 314-550
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.85e-20
Family Clostridium neurotoxins, the second last domain 0.043
Further Details:      
 
Domain Number 2 Region: 133-243
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000799
Family Cadherin 0.0036
Further Details:      
 
Domain Number 3 Region: 25-145
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000257
Family Cadherin 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000712   Gene: ENSSSCG00000000672   Transcript: ENSSSCT00000000728
Sequence length 957
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:65899679:65927193:1 gene:ENSSSCG00000000672 transcript:ENSSSCT00000000728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLLLSLVLASLLPSSSCNKANKHKPWIEAEYQGIVMENDNTVLLNPPLFALDKDAPLR
YAGEICGFRLHGSGVPFEAVILDKATGEGLIRAKEPVDCEAQKEHTFTIQAYDCGEGPDG
ANTKKSHKATVHVRVNDVNEFAPVFVERRYHAAVTEGKLYDRILRVEAIDGDCSPQYSQI
CYYEILTPNTPFLIDNDGNIENTEKLQYSGEKLYKFTVTAYDCGKKRAADDAEVEIQVKP
TCKPSWQGWNKRIEYAPGAGSLALFPGIRLETCDEPLWNIQATIELQTSHVAKGCDRDNY
SERALRKLCGAAPGEVDLLPMPGPNANWTAGLSVHYSQDSSLIYWFNGTQAVQVPLGGTA
GLGSGPQDSLSDHFTLSFWMKHGVTPNKGKKEEETIVCNTVQNEDGFSHYSLTVHGCRIA
FLYWPLLESARPVKFLWKLEQVCDDEWHHYALNLEFPTVTLYADGISFDPALIHDNGLIH
PPRREPALMIGACWAEEKNKEKEKGGDNSTDATPGDPLPIHHYFHGYLAGFSVRSGRLES
REVIECLYACREGLDYRDFESLGKGMKVHVNPSQSLLTLEGDDVETFNHALQHVAYMNTL
RFATPGVRPLRLTTAVKCFSEESCVSIPEVEGYVVVLQPDAPQILLSGTAHFARPAVDFE
GPEGVPLFPDLQITCSISHQVEAKKDESWQGTVTDTRMSDEIVHNLDGCEISLVGDDLDP
ERESLLLDMASLQQRGLELTNTSAYLTIAGVESITVYEEILRQARYRLRHGAALYARKFR
LSCSEMNGRYSSNEFVVEVSVLHSMNRVAHPSHMLSSQQFLHRGHQPPPEMAGHSLASSH
RNSMVPSAATLIIVVCVGFLVLMVVLGLVRIHSLHRRVSGAGGTPGASSDPKDPDLFWDD
SALTIIVNPMESYQSRQACVAGAAGGQQEDEDSSDSEAADSPSSDERRIIETPPHRY
Download sequence
Identical sequences 9823.ENSSSCP00000000712 ENSSSCP00000000712 ENSSSCP00000000712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]