SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000729 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000729
Domain Number 1 Region: 322-492,533-618,661-689,750-857
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.63e-86
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00065
Further Details:      
 
Domain Number 2 Region: 175-283
Classification Level Classification E-value
Superfamily RING/U-box 3.3e-37
Family Zf-UBP 0.000000824
Further Details:      
 
Domain Number 3 Region: 711-768
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000108
Family UBA domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000729   Gene: ENSSSCG00000000684   Transcript: ENSSSCT00000000745
Sequence length 859
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:66279242:66294281:-1 gene:ENSSSCG00000000684 transcript:ENSSSCT00000000745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELSEEALLSVLPTIRVPKAGDRVHKDECAFSFDTPESEGGLYICMNTFLGFSKQYVER
HFNKTGQRVYLHLRRTRRPKEEDTTAGTGDPPRKKPTRLAIGIEGGFDLSEKKFDYDEDV
KIVILPDYLEIARDGLGGLPDIVRDRVTSAVEALLSADSASRKQEVQAWDGEVRQVSRHA
FNLKQLDNPARIPPCGWKCSKCDMRENLWLNLTDGSILCGRRYFDGSGGNNHAVEHFKET
GYPLAVKLGTITPDGADVYSYDEDDMVLDPNLAEHLSHFGIDMLKMQKTDKTMTELEIDM
NQRIGEWELIQESGVPLKPLFGPGYTGIRNLGNSCYLNSVVQVLFSIPDFQRKYVDKLEK
IFQNAPTDPTQDFSTQVAKLGHGLLSGEYSKPAPESGDGEQVPEQKEVQDGIAPRMFKAL
ISKGHPEFSTNRQQDAQEFFLHLINMVERNCRSSENPNEVFRFLVEEKIKCLATEKVKYT
QRVDYIMQLPVPMDAALNKAEELLEYEEKKRQAEEEKLPLPELVRAQVPFSSCLEAYGAP
EQVDDFWSTALQAKSVAVKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDI
SQLRGTGLQPGEEELPDIAPPLVTPDEPKGSLGFYGNEDEDSFCSPHFSSPTSPMLDESV
IIQLVEMGFPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPDFANPLILPGSSGPGSTSAA
ADPPPEDCVTTIVSMGFSRDQALKALRATNNSLERAVDWIFSHIDDLDAEAAMDISEGRS
AADSISESIPVGPKVRDGPGKYQLFAFISHMGTSTMCGHYVCHIKKEGRWVIYNDQKVCA
SEKPPKDLGYIYFYQRVAS
Download sequence
Identical sequences ENSSSCP00000000729 ENSSSCP00000000729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]