SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000759 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000759
Domain Number 1 Region: 1305-1476
Classification Level Classification E-value
Superfamily vWA-like 3.94e-44
Family Integrin A (or I) domain 0.0012
Further Details:      
 
Domain Number 2 Region: 1089-1281
Classification Level Classification E-value
Superfamily vWA-like 1.35e-42
Family Integrin A (or I) domain 0.0000000515
Further Details:      
 
Domain Number 3 Region: 469-531
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000000798
Family BSTI 0.073
Further Details:      
 
Domain Number 4 Region: 116-170
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000549
Family BSTI 0.05
Further Details:      
 
Domain Number 5 Region: 595-651
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000017
Family ATI-like 0.02
Further Details:      
 
Domain Number 6 Region: 965-1018
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000605
Family ATI-like 0.056
Further Details:      
 
Domain Number 7 Region: 170-209
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000743
Family VWC domain 0.036
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000000759
Domain Number - Region: 649-715
Classification Level Classification E-value
Superfamily FnI-like domain 0.000952
Family VWC domain 0.041
Further Details:      
 
Domain Number - Region: 521-562
Classification Level Classification E-value
Superfamily FnI-like domain 0.00188
Family VWC domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000759   Gene: ENSSSCG00000000712   Transcript: ENSSSCT00000000775
Sequence length 1503
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:67005340:67078256:1 gene:ENSSSCG00000000712 transcript:ENSSSCT00000000775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTLTSDPYSFANSWALSSGEQHCQRAAPPSISCNISSEMQKGLWEQCQLLKSASVFARCH
PLVDPEPFVALCEKMLCPCAQGLQCPCPALLEYARACAQQGMLLYGWMDHSLCRPDCPAG
MEYRECVSPCTRTCQSLHINEVCQEQCVDGCSCPEGQLLDDGRCVESAECSCVHSGKRYP
PGASLSRDCNTCICRNSLWVCSNEDCPGECLVTGQSHFKSFDNRHFTFSGVCQYLLARDC
QDHTFSVIIETVQCADDPDAVCTRSVTVRLPSPHNSLVKLKHGGGVAMDGWDVQIPFLQG
DLRIQHTVMASVHLSYGEDLQIDWDGRGRLLVKLSPVYAGRTCGLCGNYNGNQGDDFLTP
AGLVEPLVEHFGNAWKLHGDCEDLRKQPTDPCSLNPRLTRFAEEACAILTSPKFQACHDA
VGPLPYLQNCHYDVCSCSDGRDCLCDAVATYAAACARRGVHIGWREPGFCALSCPPGQVY
LQCGTPCNLTCRSLSYPDEECAEDCLEGCFCPPGLYLDGSGDCVPKAQCPCYHDGEIFQP
EDIFSDHHTMCYCEDGFMHCSRAGAPGSLQPEVVLSSPLSHRSKRSLSCRPPMVKLVCPA
DNPRAEGLECAKTCQNYDLECVSTGCVSGCLCPPGMVRHENRCVALQRCPCFHQGREYAP
GETVKVDCNTCVCRDRKWSCTDHVCDASCSALGLAHYLTFDGLKYLFPGECQYVLVQDYC
GSNPGTFRILLGNEGCGYPSLKCRKRVTILVDGGEIELFDGEVMVKKPLKDETHFEVVES
GRFITVLLGSGLSVVWDRHLGISVFLKQTYQEQVCGLCGNFDGVQNNDLTGSSLQVEEDP
VDFGNSWKVSPQCADTRKVPLDTSPATCHNNVMKQTMVDSSCRILTSDIFQDCNKLVDPE
PYLDVCIYDTCSCESIGDCACFCDTIAAYARVCAQHGKVVTWRTATLCPQNCEERNLRED
GYQCEWRYNSCAPACPVTCQHPEPLACPVSCVEGCHAHCPPGKILDELLQTCVSPEDCPV
CEAAGRRLAPGKKITLNPRDPAHCQICHCDGVNLTCEACAEPVPPTEGPVSPTTPYEEDT
PEPPLHDFFCSKLLDLVFLLDGSDKLSEADFEALKVFVVGMMEHLHISQKHIRVAVVEYH
DGSHAYISLQDRKRPSELRRIASQVKYAGSEVASISEVLKYTLFQIFGRVDRPEASRIAL
LLMASQEPRRLAQNLARYLQGLKKKKVTVIPVGIGPHVSLKQIRLIEKQAPENKAFVVSG
VDELEQRKNEIISYLCDLAPEVPAPTRRPLVAQVTVAPELPGVSTLEPKKRMVLDVVFVL
EGSDKVGEANFNRSTEFVEEVIRRMDVGRDSVHVTVLQYSYVVAVEHSFREAQSKGEVLQ
RVREIRFQGGNRTNTGLALQYLSEHSFSASQGDREEAPNLVYMVTGNPASDEIKRMPGDI
QVVPIGVGPDVDMQELERLSWPNAPIFIQDFETLPREAPDLVLQRCCSGEGPHLPTQAPV
PEC
Download sequence
Identical sequences ENSSSCP00000000759 ENSSSCP00000000759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]