SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000822 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000822
Domain Number 1 Region: 2-319
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.86e-75
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000822   Gene: ENSSSCG00000000774   Transcript: ENSSSCT00000000838
Sequence length 321
Comment pep:known chromosome:Sscrofa10.2:5:72536455:72596714:1 gene:ENSSSCG00000000774 transcript:ENSSSCT00000000838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPVGLHNIGQTCCLNSLIQVLIMNVGLTKILKRMTVPRGAEEQRRNVPFQLLLLLEKMQ
DSRQKAVQPMELAYCLQKYNIPMFVQHDAAQLYLTVWNLIKDQITDVDLVARLQALYTIR
VKETFVCLECTTEHVRNSSMLTLPLSLFDMDSKPLKTLEDALHCFFQPRELSGRDKCFCE
NCGRKTCWKQVLKLSRLPQTLTLHLMRFSIKNLRTEKVCHSLYFPQSLDLNPLLETEEEP
CAAEGQPGGRYELFAVIAHMGLADFGHYCAYVRSAADGKWFCFNDSNVCWVSWEDIQCTY
GNHSFRWRETAYLLVYMMAES
Download sequence
Identical sequences A0A287A210
ENSSSCP00000000822 ENSSSCP00000000822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]