SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000833 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000833
Domain Number 1 Region: 263-320
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000119
Family ATI-like 0.043
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000000833
Domain Number - Region: 319-360
Classification Level Classification E-value
Superfamily FnI-like domain 0.0126
Family Fibronectin type I module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000833   Gene: ENSSSCG00000000785   Transcript: ENSSSCT00000000850
Sequence length 461
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:74689294:74702021:1 gene:ENSSSCG00000000785 transcript:ENSSSCT00000000850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKGSHIPEATPKYSETDAIIGEASTWGKGAYKAFNGRVFSFESSCSYTFCRHCVESGGDF
NVEIKRNNDSEIEKITVIIDNNDISISGDVILVNGESVHIPYNNKLIHIKKYGEHNVLNS
RRGILSLMWDKNNKLSLTIHKQYPTCGLCGNFNNTPGEDIDEHIANSKIPGNCPNAVSKS
YELCEDGVQHCEKIIGTYFEKCQKVSSLSNDYKIICIDEYCQNRDAKSTCDTYSELSRLC
ASDGPGIYESWRDDSAVVCEKPNCPEKHIYKECGPSNPATCSNVAPFQDSECVSGCTCPE
GYLLDDIGKKGKCVLKAYCPCESNGNVYQSGEVREGPCGSQCTCQEAKWSCTEALCPGRC
KVEGSLITTFDGVKYNHPGNCHFLAIHDKDWSISVELRPCQSGQSGTCLNSVTLLLNSSV
SVDKYIFNRDGTVTNDKIRNQSYYYSDKVQIFKVSSSYLQA
Download sequence
Identical sequences ENSSSCP00000000833 ENSSSCP00000000833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]