SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000836 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000836
Domain Number 1 Region: 398-471
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000251
Family Fibronectin type I module 0.041
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000000836
Domain Number - Region: 342-402
Classification Level Classification E-value
Superfamily FnI-like domain 0.022
Family VWC domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000836   Gene: ENSSSCG00000000787   Transcript: ENSSSCT00000000853
Sequence length 561
Comment pep:known chromosome:Sscrofa10.2:5:74904120:75021260:-1 gene:ENSSSCG00000000787 transcript:ENSSSCT00000000853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKTLEPGSYNTVISGSSHTEATTFIGGSGSPGTGSRPGAQTTVPGSQVSGSETGTTGVVL
GTTVAPGSSSTESIVPSGGSGTPGSGIIGATTSPSERTSPGSKTGITRVVSGTTVASGSS
NTEATTSLGRGETTQGGIKIVTTGVTVGTTVAPGSFNTKATTPTEVRAATGAGTAVGEWL
ALSASGFSTAFCLISGTTETGSGTTSSPGGVKTEATTFKGVGTTEAGISSGTTEVASSTT
VIPGSSNTGTTTRAGVQTKKKTSGGKVTRVIVSLLVLGTSREASETTTAPRISATAGSTS
VSKEITASPKVSSPETTAGATEDQENENKTGCPAPLPPPPVCHGPLGEEKSPGDVWTANC
HKCTCTEAKTVDCKPKECPSPPTCKTGERLIKFKANDTCCEIGHCEKRTCLFNNTDYEVG
SSFDDPNNPCVTYSCQNTGFTAVVQNCPKQTWCAEEDRVYDSKQCCYTCKSSCKPSPVNV
TVRYNGCTIKVEMARCVGECKKTVTYDYDIFQLKNSCLCCQEEDYEFRDIVLDCPDGSTL
PYRYRHITACSCLDPCQQSMT
Download sequence
Identical sequences ENSSSCP00000000836 ENSSSCP00000000836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]