SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000845 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000845
Domain Number 1 Region: 259-364
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.94e-22
Family Reprolysin-like 0.0086
Further Details:      
 
Domain Number 2 Region: 1085-1144
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000288
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 3 Region: 899-958
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000051
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 4 Region: 957-1015
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000589
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 5 Region: 1239-1296
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000902
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 6 Region: 1300-1355
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000275
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 7 Region: 1185-1240
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000445
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 8 Region: 1035-1086
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000068
Family TSP-1 type 1 repeat 0.0064
Further Details:      
 
Domain Number 9 Region: 1536-1591
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000405
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 10 Region: 840-903
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000876
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 11 Region: 1406-1469
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000085
Family TSP-1 type 1 repeat 0.0084
Further Details:      
 
Domain Number 12 Region: 1352-1411
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000275
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000000845
Domain Number - Region: 786-842
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00785
Family TSP-1 type 1 repeat 0.01
Further Details:      
 
Domain Number - Region: 1470-1518
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.034
Family TSP-1 type 1 repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000845   Gene: ENSSSCG00000000795   Transcript: ENSSSCT00000000862
Sequence length 1793
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:77324374:77484603:-1 gene:ENSSSCG00000000795 transcript:ENSSSCT00000000862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVAKWLTGLLYQLSLFITRSWEVHLHPRQEALVRTLASYEVVTPARVNEFGEVFPQSHH
FSRRKRSSEAPEPTPFRTHYRIRAYGQLFQLNLSADAAFLAAGYTEVHLGAPARQAEDRS
AVPPDLRHCFYRGQVNAREDNTAVFSICGGLMGTFKAHDGEYFLEPIMKADGSEHDEDHN
KPHLIYRQEVKRNYFLPSHKPCEVSESQIKKTTLPFHNYSNVSEDLNIKEEIVLGYSSKN
VSLEHERSQIHSRKKRFLSYPRYVEVMVTADAKMVHHHGQNLQHYVLTLMSIVAAIYKDS
SIGNLINIVIVKIIIHDEQEGPVVSFNAATTLRNFCLWQQTQNVLDDAHPSHHDTAVLIT
RYGLEITLPTEIVTLSLLHDHQYFLYAEAFYGNFRPEHWADPLEINIVMELRTHFVPLLD
LSVARKIKNYLLLVLMLHACLNYWVLLLGFFSDLFIYMKISCRYFWVGWLAKGKKKFCLR
VRLRAILAFQSLEMKTFSPLFSYQSMVLTCVYKETMKQETRECPIEWLGTKYCKSEKFTF
LFYLSDKYLNIDLTVIHQAGIGGGIELIVRNTCFTLMKCEILVQVINACNWESEPTVNSS
SQIKLGIIESFVKGYLPSLISRRDVKNISVLLVVFSISQVLYPFAALSDTQGNFLLNGNF
VVSMSKKEINIQGAIFEYSGSNNSIERINSTDRLEEELVLQVLCVGNLYNPDVRYSFSIP
TEEKSDLFTWDPYGPWQDCTKMCQGTCRDKHICSRLADSKELPKPHCSHKPAPLLCIWKC
NHIIFGRWHITGKSECSSLCGQGYKSLDIHCMKYSIHKGQTVPVDDRYCGDQLKPPTREP
CHGDCVLTRWHYSEWSQQCSRSCGGGEKSRESYCMNNFGHRLADRECQGLPRVTIENCNE
FSCPRWATSEWSECLVTCGKGTKQRQVWCQLNEDHLSDGFCDPSTKPESLRPCELHTCAS
WQVGPWGSCTATCGQGYQMRAGKCVNELLSAVLDDRLCHGASRPGDRQDCIVTPCSVIPK
VGATSLPAVPMGKIAQWRYGSWTPCSVSCGRGSQARYVSCRDAHDEIADESYCAHIPRPA
DISLCFSPCGEWQTGNWSPCSASCGHGKTTRQVLCINYHQPINENYCDPEVRPLIEQECN
LAACPPTYDHFPSSSEQPSHFRGRNFPLTHKPEDNQNQGFHPSIRGNQWRTGPWGSCSSS
CAAGVQRRVVVCQDENGQSASYCDAASRPPELKHCDLGPCPRWSYGSWGECTQTCGGGIK
SRFVICQFPNGQISREQNCDLVNKPPSVVQCHMHACPDDVSWHRGPWKSCSASCGKGLKY
REVLCVDRFHGKLEEKYCSHLRKPRTHKACRSARCPSWKANRWKQCSVTCGSGLQQRDVY
CRLRGVGRVAEEKCDRSTRPYFQRQCWHQDCIQYQWVAGGWLDCSTSCKQRETRRQVRCV
DARNLQVNESFCDPLTRPLSIKRCGNPPCKYIVVTGDSSQCAGNCGFSYRQRITYCIGIQ
STEKYKVHQLWPVDYRECPVLPSPQVYKCNFRTCLHMATWKVGKWSKCSVTCGVGVMERR
VECMAENGWSSDLCLKHLKPDAQKKCYVNDCKTFTTCKEIQVKNSSAKDGDYYLNIKGKI
IKIYCAGMHLENPKEYISLVKGEEDNFSEVYGFRLQNPYECPFNGSRRQDCECKNDYLAA
GHTVFSKIRIDLISMQIKTTDFLFAQTVFGNAIPFATAGDCYSAARCPQGQFSINLAGTG
MKIASTAKWLAQGSYASVIIHRSQDGTKVFGRCGGFCGKCIPHMTTGLPIQVI
Download sequence
Identical sequences ENSSSCP00000000844 ENSSSCP00000000845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]