SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000853 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000853
Domain Number 1 Region: 30-228
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.16e-42
Family Laminin G-like module 0.0031
Further Details:      
 
Domain Number 2 Region: 268-332
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000146
Family VWC domain 0.016
Further Details:      
 
Domain Number 3 Region: 690-762
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000303
Family VWC domain 0.012
Further Details:      
 
Domain Number 4 Region: 433-480
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000754
Family EGF-type module 0.016
Further Details:      
 
Domain Number 5 Region: 556-616
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000124
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000000853
Domain Number - Region: 333-396
Classification Level Classification E-value
Superfamily FnI-like domain 0.000178
Family Fibronectin type I module 0.091
Further Details:      
 
Domain Number - Region: 604-639
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00128
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 399-442
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00439
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000853   Gene: ENSSSCG00000000802   Transcript: ENSSSCT00000000870
Sequence length 818
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:78417882:78687030:-1 gene:ENSSSCG00000000802 transcript:ENSSSCT00000000870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPRILLRTFCLIFGLGAVWGLGVDPSLQIDVLTELELGESTTGVRQVPGLHNGTKAFLF
QDTPRSIKASTATAEQFFQKLRNKHEFTVLVTLKQTHLNSGVILSIHHLDHRYLELESSG
HRNEVRLHYRSGSHHPHTEVFPYILADDKWHKLSLAISASHLILHIDCNKIYERVVEKPS
TDLPVGTTFWLGQRNNAHGYFKGIMQDVQLLVMPQGFIAQCPDLNRTCPTCNDFHGLVQK
IMELQDILAKTSAKLSRAEQRMNRLDQCYCERTCTTKGITYREFESWTDGCKNCTCLNGT
IQCETLICPNPDCPLKSALAYVDGKCCKECKSVCQFQGQTYFEGERNTVYSSSGVCVLYE
CKDQTMKLVESSSCPALDCPESHQITLSHSCCKVCKVGYDFCSERHNCMENSVCRNLNDR
AVCSCRDGFRALREDNAYCEDVDECAEGRHYCRENTMCVNTPGSFMCICKTGYIRIDDYS
CTVHLAVVTVSKQCDRRVLCHNNIHNCVCVCINSGVMETTCKRFAFLKNHCVFGGNCFLS
AVCSSSWGTLGLSRQIDIDECSDGFVQCDSRANCINLPGWYHCECRDGYHDNGMFSPSGE
SCEDIDECGTGRHSCANDTICFNLDGGYDCRCPHGKNCTGDCVHDGKIKHSGQIWVLEND
RCSVCSCQNGFVMCRRMVCDCENPTVDLFCCPECDPRLSSQCLHQNGEILYNSGDTWVQN
CQQCRCLQGEVDCWPLPCPEVECEFSVLPENECCPRCVTDPCQADTIRNDITKTCLDEMN
VVRFTGSSWIKHGTECTLCQCKNGHICCSVDPQCLQEL
Download sequence
Identical sequences ENSSSCP00000000853 ENSSSCP00000000853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]