SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000870 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000870
Domain Number 1 Region: 403-625
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.8e-78
Family Adenain-like 0.000000000729
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000870   Gene: ENSSSCG00000000816   Transcript: ENSSSCT00000000889
Sequence length 628
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:81598190:81650808:-1 gene:ENSSSCG00000000816 transcript:ENSSSCT00000000889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNHNSIFKTHLLSQTGFAEDQLSLSDHQILPSRQGNLDRSYTCSARSTAYNANYYSDNPS
SDSFLGSGDLRTFGQSANGQWRNSTPASGSTLQKSRNSRSLYLETRKTSSGLSNTFTGKS
NHHCHVSAYEKSFPIKPVPSPSWSGSCRRNLLSPKKTQRRHVSTAEETVQEEEREIYRQL
LQMVTGKQFSVAKPTTHFPLHLSRCLSSSKNTLKDPLFKNGNSCAAHIIGSDTSSSGSAS
VLTAQEQLSHNVYSLSSYTPDVVAFGSKDSDPLHQPPQQHSLPHQPDNLPASNTQSEGSD
SVILLKVKDSQTPTPSPTFFQAELWIKELTSVYDSRARERLRQIEEQKALALQLQNQRLQ
EQEHSVHDSVELHLRVPLEKEIPVTIVQETGKKGHKLTDSEDEFPEITEEMEKEIKNVFR
NGNQDEVLSEAFRLTITRKDIQTLNHLNWLNDEIINFYMNMLMERSKEKGMPSVHAFNTF
FFTKLKTAGYQAVKRWTKKVDVFSVDILLVPIHLGVHWCLAVVDFRKKNITYYDSMGGIN
NEACRILLQYLKQESIDKKRKEFDTNGWQLFSKKSQEIPQQMNGSDCGMFACKYADCITK
DRPINFTQQHMPYFRKRMVWEILHRKLL
Download sequence
Identical sequences ENSSSCP00000000870 ENSSSCP00000000870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]