SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000893 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000893
Domain Number 1 Region: 434-928
Classification Level Classification E-value
Superfamily ALDH-like 7.72e-160
Family ALDH-like 0.000000000644
Further Details:      
 
Domain Number 2 Region: 24-223
Classification Level Classification E-value
Superfamily Formyltransferase 1.57e-49
Family Formyltransferase 0.0000000214
Further Details:      
 
Domain Number 3 Region: 227-327
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 8.32e-26
Family Post formyltransferase domain 0.0000155
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000000893
Domain Number - Region: 346-418
Classification Level Classification E-value
Superfamily ACP-like 0.00216
Family Acyl-carrier protein (ACP) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000893   Gene: ENSSSCG00000000839   Transcript: ENSSSCT00000000913
Sequence length 929
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:82894882:82958376:1 gene:ENSSSCG00000000839 transcript:ENSSSCT00000000913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWRSSQTLRRFSTGRVYFQNKLKLALIGQSLFGQEVYSHLCREGHQVVGVFTVPDKDGK
ADPLALAAEKNGTPVFKFPRWRAKGKTIKEVAEAYRSVGAELNVLPFCTQFIPMDIIESP
KHGSIIYHPSILPRHRGASAINWTLIMGDKKAGFSVFWADDGLDTGPILLQRSCDVQPND
TVDALYNRFLFPEGIKAMVEAVQLVADGKAPRIPQSEEGATYEGIQKKENAEISWDQSAE
DLHNWIRGHDKVPGAWTEINGQVVTFYGSSLLNSSVPPGEPLEIKGAKKPGLVTKNGLVL
FGNDGKALMVRNLQFEDGKMIPASQYFAAGETSVVELTAEEVKVAETIKVIWAGILSNIP
VIEDSTDFFKSGASSMDVARLVEEIRQKCGGLQLQNEDVYMATKFEDFIQKVVRKLRGDD
QEEELVVDYVSKEVNEMTVKMPYQCFINGQFTDADDGKTYDTINPTDGSIICKVSYASLV
DVDKAVAAAKDAFENGEWGRMNARERGRLMYRRNRLADLLEENQEELATIEALDSGAVYT
LALKTHIGMSVQTFRYFAGWCDKIQGSTIPINQARPNRNLTFTKKEPIGVCAIIIPWNYP
LMMLAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSVKAGFPKGVINIIPGSGGIAGQR
LSEHPDIRKLGFTGSTPIGKQIMKSCAVSNLKKVSLELGGKSPLLIFNDCELDKAVRMLL
KGMGAVFFNKGENCIAAGRLFVEESIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHKA
HLEKLLQYCEAGVKEGATLVYGGRQVQRPGFFMEPTVFTDVEDHMYLAKEESFGPIMVIS
KFRNGDIDGVLERANNTEYGLASGVFTRDINKAMYVSEKLEAGTVFINTYNKTDVAAPFG
GFKQSGFGKDLGEEALNEYLRTKTVTLEY
Download sequence
Identical sequences ENSSSCP00000000893 ENSSSCP00000000892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]