SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000909 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000909
Domain Number 1 Region: 370-448
Classification Level Classification E-value
Superfamily C-type lectin-like 1.6e-22
Family Link domain 0.0014
Further Details:      
 
Domain Number 2 Region: 313-346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family EGF-type module 0.082
Further Details:      
 
Domain Number 3 Region: 267-303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000607
Family EGF-type module 0.074
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000000909
Domain Number - Region: 139-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000292
Family EGF-type module 0.091
Further Details:      
 
Domain Number - Region: 181-303
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000471
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 6-63
Classification Level Classification E-value
Superfamily FAS1 domain 0.0145
Family FAS1 domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000909   Gene: ENSSSCG00000000852   Transcript: ENSSSCT00000000929
Sequence length 449
Comment pep:novel chromosome:Sscrofa10.2:5:84229874:84256705:-1 gene:ENSSSCG00000000852 transcript:ENSSSCT00000000929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVLAVDLPRFATWKTLQGSELSVKCGAGSDIGELFLNGQTCRIVQRELLFDLGVAYGIDC
LLIDPTLGGRCDTFTTFNVSGNCGSCISTPSCPRWTKPKGQKQKCLYNLPFKRNVEGCKQ
QCTLVIQLPRCCRGYFWPDCQACPGGPDTPCNNRGVCLDQYSPMGQCKCNAGFTGTACEL
CWPGRFGPDCQPCGCSDHGQCDDGITGSGQCVCETGWIGRFCDTQTAVPPVCTPPCSAHA
TCTENSTCECNLNYEGDGITCTVVDFCKQNNGGCAKVATCSQKGTKVSCSCQKGYQGDGH
SCTEIDPCADGLNGGCHEHATCRMTGPGKRKCECKSHYVGDGLDCEPEQLPIDRCLQDNG
QCHADADCADLHFQDTTIGVFHLRSPLGQYKLTFDKAKEACAKEAATVATYNQLAYAQKA
KYHLCSAGWLDGGRVGYPTSYASQNCGSG
Download sequence
Identical sequences ENSSSCP00000000909 ENSSSCP00000000909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]