SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000911 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000911
Domain Number 1 Region: 747-898
Classification Level Classification E-value
Superfamily FAS1 domain 1.05e-26
Family FAS1 domain 0.0022
Further Details:      
 
Domain Number 2 Region: 293-425
Classification Level Classification E-value
Superfamily FAS1 domain 9.42e-25
Family FAS1 domain 0.0019
Further Details:      
 
Domain Number 3 Region: 906-1034
Classification Level Classification E-value
Superfamily FAS1 domain 3.79e-21
Family FAS1 domain 0.0063
Further Details:      
 
Domain Number 4 Region: 101-274
Classification Level Classification E-value
Superfamily FAS1 domain 6.02e-19
Family FAS1 domain 0.0038
Further Details:      
 
Domain Number 5 Region: 1347-1413
Classification Level Classification E-value
Superfamily FAS1 domain 0.0000000051
Family FAS1 domain 0.0071
Further Details:      
 
Domain Number 6 Region: 1237-1294
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000914
Family EGF-type module 0.042
Further Details:      
 
Domain Number 7 Region: 1279-1337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000067
Family EGF-like domain of nidogen-1 0.052
Further Details:      
 
Domain Number 8 Region: 584-722
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000541
Family Growth factor receptor domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000000911
Domain Number - Region: 4-124
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000104
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 1206-1239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00301
Family EGF-type module 0.094
Further Details:      
 
Domain Number - Region: 724-758
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00838
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 507-551
Classification Level Classification E-value
Superfamily EGF/Laminin 0.037
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000911   Gene: ENSSSCG00000000854   Transcript: ENSSSCT00000000931
Sequence length 1414
Comment pep:novel chromosome:Sscrofa10.2:5:84334737:84425007:1 gene:ENSSSCG00000000854 transcript:ENSSSCT00000000931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INPCSQNICHPHAWCTYLGPNRHSCTCQEGYRGDGQVCFPVDPCQVNFGNCPTDSSVCRY
DGPGQSHCECREHYHNFVPGVGCSMTDICESHNPCHRDARCTTIAPGQTKCTCRKGYIGD
GSRCYGNIMERLRELNTEPGGKWQGRLTSFISLLDFNSQDKAYAWPLSNLGPFTLLLPTD
KGLKGFNVKELLKDNEAARYFVKLHIIAGQMNTEQMTTLQMKTFYTLTGKPGEIFNGDKD
NQVKLKLYGGKKKVNIIQGNIIASNGLLHILDRAMDKVAPTFESNNEQTIMTMLQPRYSK
FRSLLEETNMGHALDEDGVGGPYTIFVPSNEALNNMKDGALDYLLSSEGSRKLLELVRYH
IVPFTQLEVATLISTPHIRSMANQVIRFNTTDNGQILANGVAMEETEVAAKNGRIYTLTG
VLIPPSITPVLPHRCDEMKREMKLGTCVSCSLVYWSKCPADSEPMTLFTHKCVYTGRIRS
LKNGCARYCNATVKIPKCCEGFYGPDCIQCPGGFLNPCSGNGQCADGLDGNGTCICQDGF
RGSQCQFCADPNKYGPQCDKRCLCIFGTCDNRIDSDGACLPGTCREGSAGRFCHKHTSAC
GPYMEFCHIHATCEYSNGTASCVCKAGYEGDGSLCSETDPCSGLTPGGCSRNAECIKTGR
GTHTCVCHQGWTGDGRDCSAINTCLLPRAGGCHHNATCLYVGPGQNECECKKGFRGNGID
CELITSCLEQTGRCHPLATCQFTSGVWSCVCPEGYEGDGLLCYGNAAVELSFLSAAAVFN
QWINSASLQPLLSATSNLTVLVPSRQAIEDLDQEEKAFWLTKSNIPALIKYHTLLGTYGV
ADLQALSPSDMLATSLQGSFLHLAKVNGNITIEGASVIDGDNAATNGVIHIINKVLLPQR
GLTGSLPNLLTRLDQMPDYSIFRGYIIQYNLASTIEAADAYTVFAPNNDAIESYIREKKV
TTLEEDVLRYHVVLEEKLLKNDLHTGMHRETMLGFSYLLGFFLHNDQLYVNEAPINYTNA
ATDKGVIHGLGKVLEIQKNRCDVNDTTIVRGKCGKCPQQPICPFGTKPLGDETRRCLYTI
YFMGKRSLFIGCQPKCVKTVITKECCAGYFGPQCQPCPGSAEGICFGNGICLDGANGTGV
CECGGGFGGTACETCVEGKYGAHCDQVCTCVHGRCNQGPSGDGSCDCDVGWRGVKCDSEI
TKDNCNGTCHTSANCLLNPDGTASCKCAAGFQGNGTVCTAINACEISNGGCSAKAICKRT
TPGSRECVCKAGYTGDGIVCLEINPCLENNGGCHRHAECTQTGPNQAVCNCLAKYTGDGK
VCTLIDVCLTENGGCSKFAFCNHNEQDGRTCTCKPDYIGDGFTCRGNIHQELPKNPQTSQ
YYFQLQEHSIHDLLGPGPFTVLAPSSAAFDAEPQ
Download sequence
Identical sequences ENSSSCP00000000911 ENSSSCP00000000911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]