SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001010 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001010
Domain Number 1 Region: 1172-1354
Classification Level Classification E-value
Superfamily AbfB domain 2.88e-27
Family AbfB domain 0.011
Further Details:      
 
Domain Number 2 Region: 734-791
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000159
Family BSTI 0.022
Further Details:      
 
Domain Number 3 Region: 1777-1838
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000425
Family BSTI 0.013
Further Details:      
 
Domain Number 4 Region: 832-900
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000899
Family ATI-like 0.027
Further Details:      
 
Domain Number 5 Region: 377-436
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000948
Family ATI-like 0.023
Further Details:      
 
Domain Number 6 Region: 1365-1418
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000997
Family BSTI 0.082
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000001010
Domain Number - Region: 893-939
Classification Level Classification E-value
Superfamily FnI-like domain 0.00314
Family Fibronectin type I module 0.062
Further Details:      
 
Domain Number - Region: 2177-2236
Classification Level Classification E-value
Superfamily FnI-like domain 0.0178
Family VWC domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001010   Gene: ENSSSCG00000000943   Transcript: ENSSSCT00000001032
Sequence length 2283
Comment pep:known_by_projection chromosome:Sscrofa10.2:5:105853485:106003580:-1 gene:ENSSSCG00000000943 transcript:ENSSSCT00000001032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPWSICWVHILLFSLQGSICSSSVLTRTSKNGFHENPQKRALLAAQIEATSPRYFFHEA
FNWGESKIKGSCPHECLNGAFCSKAGTCDCQIFQALGTRCQIVPNMGSGRDGVCKTWGQY
HFETFDGIYYYFPGNCSYIFAKDCGNLEPQYTVWVHNSPKCLGSVYYCYRSISLFFSDQE
EIQIYGHEIKKNGISLTLPQTIGQVFIEKLADYILVKTTFGVSLAWDGISGIYLKLSEEH
RGKSCGLCANYNGLQSDDFIVQQEDYTEDIAMFANSWLVQTADDTKCIPTPSDFPNPCSS
GIPAFEAIFFKCQILLQFPFLSCHEYIDPYLYIASCVNDLCKTHDDDTYCRAATEYARAC
SHAGYPIQDWRDDFPACIDKCDDSFVHRDCISCCPPTCTFEKQCLGSNLRCLDGCYCPDG
LVMENGTCISLENCPCNFHGLAYSVGSKIEQECTECVCVGGVWNCTEHDCPVQCSVVGDS
HFTTFDGRHYSFIGMCQYILVKGTGKDKFTITLQKAHCEQNLGLVCLQSITLILEDDFNK
QVTLSRGGQILTSPKQGFHLNGIVEIQTLSSLFILLKTTFGLKILFAVDGERIYIQLTSA
WKRRTLGLCGTFNGNIRDDFLSPAGMIEGTPQLHANAWRVSSTCFAPVHVPVVDPCNINQ
QNIGYAAHCDAIHQELFAPCHIYISPGLYYQLCRHDACKCGSPCLCNALAHYAYLCGQRG
VPINFRAQVSFCGVVCQKGMLYHHCASFCRRSCVSLSSLEQCPEDCAEGCSCPEGKYYED
TLSFCVPISHCRCHYRGSVYQPGELIPTPSGLCQCSNGTVKCDELATPSTVHVCPEGKQY
FDCRFPDPELPAGGVNCETTCANLAMNFTCAPSSPCISGCVCAPGMAEHKGKCYVPESCP
CVWKDWERLAGEAVATPCYTCVCRRGMFNCTYYPCPAVCTVYGDRHYHSFDGLEYDYISD
CQVFLIKSTDDSDISVIAQNKKCFDNDIVCSKSVLISVGDTEIYLNDTPYKQKRSGFFLE
NKPTYQLWKAGLYMVVYFPEKDITILWDKKTTIHIKVGPQWKSKLSGLCGNFDKCTSNDM
TTSNNLEVRNAQVFGDSWALGQCEAPSEPLKPCEAHQNKFPYAKKECSILYSDVFAPCRN
VIDVTSFAKNCHEDTCNCNLGGDCECLCTSVAAYAHKCCQEGVPVRWRSSSVCSLDCEYY
NEGLGEGPYMLASYGHSGFILGANMTSGSIFSLSRSSIHGNLFFNFMITPGLFKEKASTL
VLVSLESAERPNYFFFVQDDDSLRLKLWEASSAFHRRATFFHHQGLWIPSYSAFELYSKK
GFFIILTDSSARASKYDDSEEFKHLSSFRIEETQAAVPYRRMCEWRYEPCATPCFKTCSD
PEALACKFLPPVEGCLPYCPKNMILDEVTLKCVYPEDCIPLMPTEPALISPVFTVFDMLT
PTTGLECEPQKFDPVYNCSQYICLNMEWKLYNWSLHCPKGLETPDCGFRGRPVQVNRDVC
CPEWECPCRCSMLSELSIVTFDGNNAALYSMASYILVRVPGEVIVAHIEKCSMNQNGNSF
KKLASSGRISGLCFKKLNLTTSLHEILVNRAERKVHVDSAAVPLPFAKQDLSIEDSGSMY
VIATPAGLMVKWAHLTGIVDIHFGSQFNLSSHTEGLCGICNEDPDDDLRMQNGTIITNME
DIELFIESWEIEKSFKVTTRRPVRNCTEHDCSHCIELLNRKAFIPCHDKVSPQDFCEKMW
INYTYFWNYECDALSAYVALCNKFDVCIRWRTPDYCPLSCPEGKEYQPCVQPCEARTCLN
RWFYGYSSCLKLREDCVCKNGTILHRPDSTRCIPEKECACTDSEDRPRTAGEVWNGGIDE
CALYRCLENSSIIPIEPDCDEAPSPVCEREAQVVLSFVDKWTCCSKEVCSCDMTLCETAI
PTCTDSQKLIIGHSPFSCCPQYLCECDPSKCPVISIPECREDQFMIQVQQEEPCCFSPLC
VCKPCTQPIPLCADGEFLTLDLNTTHVCCPQYYCVCEPNLCPMPLLNCAEDMKLVKENVS
GQCCPTWHCECSCENLVMPTCKVGEFAAVDRSFQSDCGCVQYLCEKDDVCVFQEVSVLNP
GQSMIKYLEGDFCYTAECLEEKDNHTGFHTLNITVVNCSKECDVHQVYTPSPSDYDCCGT
CKNVSCKFQMDNGTLVVYEEGSTWHYNCTTFECVKTDEGAMILNYSVVCPPFNETECKMN
EGVIKLYNEGCCKICKREERLCQKVIIKSVIRKQDCVSQSSVMHLVKGNAPQLPYITSTL
RAI
Download sequence
Identical sequences ENSSSCP00000001010 ENSSSCP00000001010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]