SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001089 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001089
Domain Number 1 Region: 93-204
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.3e-32
Family Transglutaminase, two C-terminal domains 0.00000341
Further Details:      
 
Domain Number 2 Region: 206-304
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.49e-28
Family Transglutaminase, two C-terminal domains 0.00000419
Further Details:      
 
Domain Number 3 Region: 11-78
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0000000000000687
Family Transglutaminase core 0.0000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001089   Gene: ENSSSCG00000024310   Transcript: ENSSSCT00000001111
Sequence length 308
Comment pep:known chromosome:Sscrofa10.2:7:3952949:3988957:-1 gene:ENSSSCG00000024310 transcript:ENSSSCT00000001111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAARKRKERVDVNSDVIYITAKKDGTHVVKTLDTTHIGKLIVTKQVGADGMKDITDTYKF
QEGQEEERLALETALMYGAKKPLSTEGIPKSRSDIHMDFEVERAVLGRDFKVVLTFRNNS
PTRYSVTAYLSGNITFYTGVSKGEFKNETFNVTLEPLSFKTEAVWVRAGEYMGQLLEQAF
LHFFVTARVNETNDVLAKQKSVVLTIPKISVKVRGTQAVGSDMVVTVEFTNPLNEPLQNV
WMRLDGPGVTRPLRKIFREIRPNATVQWEEVCRPWVSGPRKLMASMTSDSLRHVYGELNL
HIQRRPSV
Download sequence
Identical sequences ENSSSCP00000001088 ENSSSCP00000001088 ENSSSCP00000001089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]