SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001127 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001127
Domain Number 1 Region: 2-118
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-27
Family SPRY domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001127   Gene: ENSSSCG00000001056   Transcript: ENSSSCT00000001150
Sequence length 500
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:10287341:10323692:-1 gene:ENSSSCG00000001056 transcript:ENSSSCT00000001150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YMGIGLSAQGVNMNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLI
NNTCFYTKNGHSLGIAFTDLPPNLYPTVGLQTPGEVVDANFGQHPFVFDIEDYMREWRTK
IQAQIDRFPIGDREGEWQTMIQKMVSSYLVHHGYCATAEAFARSTDQTVLEELASIKNRQ
RIQKLVLAGRMGEAIETTQQLYPSLLERNPNLLFTLKVRQFIEMVNGTDSEVRCLGGRSP
KSQDSYPVSPRPFSSPSMSPSHGMNIHNLASGKGSTAHFSGFESCSNGVISNKAHQSYCH
SKHQSSNLNVPELNSINMSRSQQVNNFTSNDVDMETDHYSNGVGETSSNGFLNGSSKHDH
EMEDCDTEMEVDSSQLRRQLCGGSQAAIERMIHFGRELQAMSEQLRRECGKNTANKKMLK
DAFSLLAYSDPWNSPVGNQLDPIQREPVCSALNSAILETHNLPKQPPLALAMGQATQCLG
LMARSGIGSCAFATVEDYLH
Download sequence
Identical sequences ENSSSCP00000001127 ENSSSCP00000001127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]