SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001288 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001288
Domain Number 1 Region: 412-596
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.62e-69
Family SPRY domain 0.00000325
Further Details:      
 
Domain Number 2 Region: 108-184
Classification Level Classification E-value
Superfamily RING/U-box 8.01e-19
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 3 Region: 195-255
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.43e-18
Family B-box zinc-binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001288   Gene: ENSSSCG00000001219   Transcript: ENSSSCT00000001317
Sequence length 617
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:24432580:24451613:-1 gene:ENSSSCG00000001219 transcript:ENSSSCT00000001317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRVGLARAGRGYPVSVAPRGHRLPRLPAPEAPRPVSPRAAGKASQVLGGENCPALSPGGA
ALRQPGSPPRAAPKQRTGGKSRRVGLLAGLGSRAHARAPPRARAMASGSVAECLQQETTC
PVCLQYFVEPMMLDCGHNICCACLARCWGAAETNVSCPQCRETFPQRHMRPNRHLANVTQ
LVKQLRTERPSGPGGEMGVCEKHREPLKLYCEEDQMPICVVCDRSREHRGHSVLPLEEAV
EGFKEQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMEREKIVWEFEQLYHSLKEH
EYRLLARLEELDLAIYNSINGAITQFSCNISHLSNLIAQLEEKQQQPTRELLQDIGDTLS
RAERIRIPEPWITPPDLQEKIHIFAQKCLFLTESLKQFTEKMQSDMEKIQELREAQLYSV
DVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCVLGSPCFIAGRHYWEVE
VGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWALTSPMTALPLRTPLQRV
GIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYSGGKSAAPLIICPMSGID
GFSGHVGNHGHSMETSP
Download sequence
Identical sequences ENSSSCP00000028411 ENSSSCP00000001288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]