SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001308 from Sus scrofa 76_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001308
Domain Number 1 Region: 441-536
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-21
Family SPRY domain 0.0013
Further Details:      
 
Domain Number 2 Region: 5-81
Classification Level Classification E-value
Superfamily RING/U-box 3.53e-20
Family RING finger domain, C3HC4 0.0049
Further Details:      
 
Domain Number 3 Region: 307-379
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000166
Family SPRY domain 0.0044
Further Details:      
 
Domain Number 4 Region: 98-158
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000101
Family B-box zinc-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001308   Gene: ENSSSCG00000001232   Transcript: ENSSSCT00000001339
Sequence length 543
Comment pep:novel chromosome:Sscrofa10.2:7:24770594:24781751:-1 gene:ENSSSCG00000001232 transcript:ENSSSCT00000001339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAASPLRNLEDEVLCSICLDYLRDPVTIDCGHVFCYHCIMKVCESARQPLHCSLCKTAF
KTESIRHVWQMASLVESIWRMKADEERQPREERQREQRAEELCGQHLEKLHYYCKDDQQI
LCVMCRESREHRHHAAVLLEKAAQPHRGKILNHLKVLKGDRDRIQNLQSTGEDEIQALLA
KFQNHKQDIASVFEQGHRFLREREQYLLECLEGMEQELTEGRNSHVTKGSEEVVRLGTLI
TELENKARQPALELLQDPSDIINRYPRKKFWIEKPISPAIKKRAEEFSDKLLSLEKGLRG
FHGKLMRDLEYKTMRISLNSQTANGYLSVSPNGKSMVFTGLWMNKYQHGQRFDPEPGVLG
SKGFTWGKVYWEVKVDRIWWGAEEEEEAMKYRGETRGVFGSSYVGGFIGITDGYSSPGYR
DENEELEEEWSQENGIWPKFCLVGVARESVVRRGFLSFTPEEGFWTLQLSSAGVCICTSL
EPFQILSYCPRQIGVALDYDGGKVAFTNARTHEFIYEFSSSFSGRIFPFLWLNCMRSRLT
LRP
Download sequence
Identical sequences ENSSSCP00000001308 ENSSSCP00000001308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]